Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 331678..332264 Replicon chromosome
Accession NZ_CP124702
Organism Klebsiella pneumoniae strain KP21315

Toxin (Protein)


Gene name doc Uniprot ID -
Locus tag QJQ34_RS01545 Protein ID WP_023285605.1
Coordinates 331896..332264 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag QJQ34_RS01540 Protein ID WP_004174006.1
Coordinates 331678..331899 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJQ34_RS01520 (327835) 327835..328761 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
QJQ34_RS01525 (328758) 328758..330035 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
QJQ34_RS01530 (330032) 330032..330799 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
QJQ34_RS01535 (330801) 330801..331514 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
QJQ34_RS01540 (331678) 331678..331899 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QJQ34_RS01545 (331896) 331896..332264 + 369 WP_023285605.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
QJQ34_RS01550 (332537) 332537..333853 + 1317 WP_002920796.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
QJQ34_RS01555 (333960) 333960..334847 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
QJQ34_RS01560 (334844) 334844..335689 + 846 WP_004145129.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
QJQ34_RS01565 (335691) 335691..336761 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 328758..337498 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13534.89 Da        Isoelectric Point: 8.6410

>T281103 WP_023285605.1 NZ_CP124702:331896-332264 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGITVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT281103 WP_004174006.1 NZ_CP124702:331678-331899 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References