Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
Location | 4074364..4074961 | Replicon | chromosome |
Accession | NZ_CP124698 | ||
Organism | Klebsiella pneumoniae strain KP21317 |
Toxin (Protein)
Gene name | higB | Uniprot ID | R4YIC5 |
Locus tag | QJQ33_RS19960 | Protein ID | WP_004142563.1 |
Coordinates | 4074644..4074961 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | R4YH91 |
Locus tag | QJQ33_RS19955 | Protein ID | WP_004142561.1 |
Coordinates | 4074364..4074651 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJQ33_RS19925 (4070444) | 4070444..4070692 | + | 249 | WP_002893037.1 | DUF1158 domain-containing protein | - |
QJQ33_RS19930 (4070710) | 4070710..4071051 | - | 342 | WP_002893035.1 | RamA family antibiotic efflux transcriptional regulator | - |
QJQ33_RS19935 (4071082) | 4071082..4072197 | - | 1116 | WP_020316605.1 | MBL fold metallo-hydrolase | - |
QJQ33_RS19940 (4072377) | 4072377..4072958 | + | 582 | WP_004176968.1 | TetR/AcrR family transcriptional regulator | - |
QJQ33_RS19945 (4072958) | 4072958..4073326 | + | 369 | WP_004142557.1 | MmcQ/YjbR family DNA-binding protein | - |
QJQ33_RS19950 (4073446) | 4073446..4074099 | + | 654 | WP_004178896.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
QJQ33_RS19955 (4074364) | 4074364..4074651 | - | 288 | WP_004142561.1 | helix-turn-helix transcriptional regulator | Antitoxin |
QJQ33_RS19960 (4074644) | 4074644..4074961 | - | 318 | WP_004142563.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QJQ33_RS19965 (4075146) | 4075146..4076189 | - | 1044 | WP_004178895.1 | DUF2157 domain-containing protein | - |
QJQ33_RS19970 (4076856) | 4076856..4077722 | - | 867 | WP_059689649.1 | helix-turn-helix transcriptional regulator | - |
QJQ33_RS19975 (4077831) | 4077831..4079258 | + | 1428 | WP_004176980.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12110.39 Da Isoelectric Point: 11.2767
>T281093 WP_004142563.1 NZ_CP124698:c4074961-4074644 [Klebsiella pneumoniae]
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M5MXH8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0S3DIQ1 |