Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
| Location | 8873..9547 | Replicon | plasmid p4-KP21300 |
| Accession | NZ_CP124697 | ||
| Organism | Klebsiella pneumoniae strain KP21300 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A5Q9LMS5 |
| Locus tag | QJQ26_RS28670 | Protein ID | WP_032720638.1 |
| Coordinates | 8873..9196 (+) | Length | 108 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QJQ26_RS28675 | Protein ID | WP_032720637.1 |
| Coordinates | 9245..9547 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJQ26_RS28645 (QJQ26_28645) | 6097..7065 | + | 969 | WP_004099053.1 | IS5-like element IS903B family transposase | - |
| QJQ26_RS28650 (QJQ26_28650) | 7214..7816 | + | 603 | Protein_5 | RNA-guided endonuclease TnpB family protein | - |
| QJQ26_RS28655 (QJQ26_28655) | 7885..8312 | - | 428 | Protein_6 | DNA-binding protein | - |
| QJQ26_RS28660 (QJQ26_28660) | 8377..8511 | - | 135 | WP_269233001.1 | hypothetical protein | - |
| QJQ26_RS28665 (QJQ26_28665) | 8543..8695 | + | 153 | WP_269233002.1 | DUF4113 domain-containing protein | - |
| QJQ26_RS28670 (QJQ26_28670) | 8873..9196 | + | 324 | WP_032720638.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QJQ26_RS28675 (QJQ26_28675) | 9245..9547 | + | 303 | WP_032720637.1 | NadS family protein | Antitoxin |
| QJQ26_RS28680 (QJQ26_28680) | 9590..9757 | - | 168 | WP_153591440.1 | hypothetical protein | - |
| QJQ26_RS28685 (QJQ26_28685) | 9945..10151 | - | 207 | WP_153591439.1 | hypothetical protein | - |
| QJQ26_RS28690 (QJQ26_28690) | 10148..10531 | - | 384 | WP_214603307.1 | hypothetical protein | - |
| QJQ26_RS28695 (QJQ26_28695) | 10636..11208 | - | 573 | WP_032720635.1 | GNAT family N-acetyltransferase | - |
| QJQ26_RS28700 (QJQ26_28700) | 11210..12022 | - | 813 | WP_223203129.1 | TSUP family transporter | - |
| QJQ26_RS28705 (QJQ26_28705) | 12034..12954 | - | 921 | WP_050548604.1 | TauD/TfdA family dioxygenase | - |
| QJQ26_RS28710 (QJQ26_28710) | 13257..13751 | - | 495 | WP_044266755.1 | hypothetical protein | - |
| QJQ26_RS28715 (QJQ26_28715) | 13782..14354 | - | 573 | WP_044266753.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | qnrS1 / dfrA14 / tet(D) | - | 1..62484 | 62484 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 12372.29 Da Isoelectric Point: 9.6240
>T281084 WP_032720638.1 NZ_CP124697:8873-9196 [Klebsiella pneumoniae]
MNYLEFVETSAFSGLRKELMDDDEFRELQTYLLEAHDRGDTISHTGGCRKIRWGRPGMGKRGGVRVIYYVRLASGRLYLL
LIYPKNAKDELSEKEKAVMKALTQQLK
MNYLEFVETSAFSGLRKELMDDDEFRELQTYLLEAHDRGDTISHTGGCRKIRWGRPGMGKRGGVRVIYYVRLASGRLYLL
LIYPKNAKDELSEKEKAVMKALTQQLK
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|