Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
Location | 3859544..3860141 | Replicon | chromosome |
Accession | NZ_CP124693 | ||
Organism | Klebsiella pneumoniae strain KP21300 |
Toxin (Protein)
Gene name | higB | Uniprot ID | R4YIC5 |
Locus tag | QJQ26_RS18955 | Protein ID | WP_004142563.1 |
Coordinates | 3859824..3860141 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | R4YH91 |
Locus tag | QJQ26_RS18950 | Protein ID | WP_004142561.1 |
Coordinates | 3859544..3859831 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJQ26_RS18920 (3855625) | 3855625..3855873 | + | 249 | WP_002893037.1 | DUF1158 domain-containing protein | - |
QJQ26_RS18925 (3855891) | 3855891..3856232 | - | 342 | WP_002893035.1 | RamA family antibiotic efflux transcriptional regulator | - |
QJQ26_RS18930 (3856263) | 3856263..3857378 | - | 1116 | WP_020316605.1 | MBL fold metallo-hydrolase | - |
QJQ26_RS18935 (3857557) | 3857557..3858138 | + | 582 | WP_004176968.1 | TetR/AcrR family transcriptional regulator | - |
QJQ26_RS18940 (3858138) | 3858138..3858506 | + | 369 | WP_004142557.1 | MmcQ/YjbR family DNA-binding protein | - |
QJQ26_RS18945 (3858626) | 3858626..3859279 | + | 654 | WP_004178896.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
QJQ26_RS18950 (3859544) | 3859544..3859831 | - | 288 | WP_004142561.1 | helix-turn-helix transcriptional regulator | Antitoxin |
QJQ26_RS18955 (3859824) | 3859824..3860141 | - | 318 | WP_004142563.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QJQ26_RS18960 (3860326) | 3860326..3861369 | - | 1044 | WP_032419264.1 | DUF2157 domain-containing protein | - |
QJQ26_RS18965 (3862036) | 3862036..3862902 | - | 867 | WP_032419265.1 | helix-turn-helix transcriptional regulator | - |
QJQ26_RS18970 (3863011) | 3863011..3864438 | + | 1428 | WP_004176980.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12110.39 Da Isoelectric Point: 11.2767
>T281077 WP_004142563.1 NZ_CP124693:c3860141-3859824 [Klebsiella pneumoniae]
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M5MXH8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0S3DIQ1 |