Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
| Location | 5331724..5332319 | Replicon | chromosome |
| Accession | NZ_CP124670 | ||
| Organism | Pseudomonas aeruginosa strain 2021CK-01536 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A241XLJ5 |
| Locus tag | QJ974_RS24755 | Protein ID | WP_003117425.1 |
| Coordinates | 5332041..5332319 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QJ974_RS24750 | Protein ID | WP_003113527.1 |
| Coordinates | 5331724..5332029 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJ974_RS24715 (QJ974_24715) | 5326864..5327712 | + | 849 | WP_003117426.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
| QJ974_RS24725 (QJ974_24725) | 5327879..5328820 | + | 942 | WP_003099281.1 | ribose-phosphate pyrophosphokinase | - |
| QJ974_RS24730 (QJ974_24730) | 5328937..5329551 | + | 615 | WP_003099279.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
| QJ974_RS24735 (QJ974_24735) | 5329593..5330177 | + | 585 | WP_003099278.1 | aminoacyl-tRNA hydrolase | - |
| QJ974_RS24740 (QJ974_24740) | 5330218..5331318 | + | 1101 | WP_003099270.1 | redox-regulated ATPase YchF | - |
| QJ974_RS24750 (QJ974_24750) | 5331724..5332029 | - | 306 | WP_003113527.1 | HigA family addiction module antitoxin | Antitoxin |
| QJ974_RS24755 (QJ974_24755) | 5332041..5332319 | - | 279 | WP_003117425.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QJ974_RS24760 (QJ974_24760) | 5332372..5332500 | - | 129 | Protein_4890 | integrase | - |
| QJ974_RS24765 (QJ974_24765) | 5332648..5334876 | + | 2229 | WP_003113525.1 | TonB-dependent receptor | - |
| QJ974_RS24770 (QJ974_24770) | 5334946..5335593 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
| QJ974_RS24775 (QJ974_24775) | 5335655..5336893 | - | 1239 | WP_014603324.1 | C69 family dipeptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10701.28 Da Isoelectric Point: 8.5576
>T281062 WP_003117425.1 NZ_CP124670:c5332319-5332041 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAARELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|