Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 5542965..5543560 | Replicon | chromosome |
| Accession | NZ_CP124669 | ||
| Organism | Pseudomonas aeruginosa strain 2021CK-01494 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | V6ALY3 |
| Locus tag | QKA38_RS25845 | Protein ID | WP_003113526.1 |
| Coordinates | 5543282..5543560 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A0S3KUN4 |
| Locus tag | QKA38_RS25840 | Protein ID | WP_003111575.1 |
| Coordinates | 5542965..5543270 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QKA38_RS25820 (QKA38_25820) | 5538293..5538625 | + | 333 | WP_031628025.1 | hypothetical protein | - |
| QKA38_RS25825 (QKA38_25825) | 5538631..5540955 | - | 2325 | WP_023098119.1 | DEAD/DEAH box helicase | - |
| QKA38_RS25830 (QKA38_25830) | 5540952..5541653 | - | 702 | WP_023098120.1 | hypothetical protein | - |
| QKA38_RS25835 (QKA38_25835) | 5541673..5542584 | - | 912 | WP_023098121.1 | restriction endonuclease | - |
| QKA38_RS25840 (QKA38_25840) | 5542965..5543270 | - | 306 | WP_003111575.1 | HigA family addiction module antitoxin | Antitoxin |
| QKA38_RS25845 (QKA38_25845) | 5543282..5543560 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QKA38_RS25850 (QKA38_25850) | 5543613..5543741 | - | 129 | Protein_5107 | integrase | - |
| QKA38_RS25855 (QKA38_25855) | 5543889..5546117 | + | 2229 | WP_021264080.1 | TonB-dependent receptor | - |
| QKA38_RS25860 (QKA38_25860) | 5546188..5546835 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
| QKA38_RS25865 (QKA38_25865) | 5546897..5548135 | - | 1239 | WP_023098122.1 | C69 family dipeptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T281057 WP_003113526.1 NZ_CP124669:c5543560-5543282 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V6ALY3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0S3KUN4 |