Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 5541442..5542037 | Replicon | chromosome |
Accession | NZ_CP124668 | ||
Organism | Pseudomonas aeruginosa strain 2021CK-01445 |
Toxin (Protein)
Gene name | higB | Uniprot ID | V6ALY3 |
Locus tag | QJ951_RS25840 | Protein ID | WP_003113526.1 |
Coordinates | 5541759..5542037 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A0S3KUN4 |
Locus tag | QJ951_RS25835 | Protein ID | WP_003111575.1 |
Coordinates | 5541442..5541747 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJ951_RS25815 (QJ951_25815) | 5536770..5537102 | + | 333 | WP_031628025.1 | hypothetical protein | - |
QJ951_RS25820 (QJ951_25820) | 5537108..5539432 | - | 2325 | WP_023098119.1 | DEAD/DEAH box helicase | - |
QJ951_RS25825 (QJ951_25825) | 5539429..5540130 | - | 702 | WP_023098120.1 | hypothetical protein | - |
QJ951_RS25830 (QJ951_25830) | 5540150..5541061 | - | 912 | WP_023098121.1 | restriction endonuclease | - |
QJ951_RS25835 (QJ951_25835) | 5541442..5541747 | - | 306 | WP_003111575.1 | HigA family addiction module antitoxin | Antitoxin |
QJ951_RS25840 (QJ951_25840) | 5541759..5542037 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QJ951_RS25845 (QJ951_25845) | 5542090..5542218 | - | 129 | Protein_5106 | integrase | - |
QJ951_RS25850 (QJ951_25850) | 5542366..5544594 | + | 2229 | WP_021264080.1 | TonB-dependent receptor | - |
QJ951_RS25855 (QJ951_25855) | 5544665..5545312 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
QJ951_RS25860 (QJ951_25860) | 5545374..5546612 | - | 1239 | WP_023098122.1 | C69 family dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T281051 WP_003113526.1 NZ_CP124668:c5542037-5541759 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V6ALY3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0S3KUN4 |