Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 5574695..5575290 | Replicon | chromosome |
| Accession | NZ_CP124667 | ||
| Organism | Pseudomonas aeruginosa strain 2021CK-01315 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | V6ALY3 |
| Locus tag | QKA52_RS26160 | Protein ID | WP_003113526.1 |
| Coordinates | 5575012..5575290 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A0S3KUN4 |
| Locus tag | QKA52_RS26155 | Protein ID | WP_003111575.1 |
| Coordinates | 5574695..5575000 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QKA52_RS26120 (QKA52_26120) | 5569835..5570683 | + | 849 | WP_003099284.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
| QKA52_RS26130 (QKA52_26130) | 5570850..5571791 | + | 942 | WP_003099281.1 | ribose-phosphate pyrophosphokinase | - |
| QKA52_RS26135 (QKA52_26135) | 5571908..5572522 | + | 615 | WP_003099279.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
| QKA52_RS26140 (QKA52_26140) | 5572564..5573148 | + | 585 | WP_003099278.1 | aminoacyl-tRNA hydrolase | - |
| QKA52_RS26145 (QKA52_26145) | 5573189..5574289 | + | 1101 | WP_003099270.1 | redox-regulated ATPase YchF | - |
| QKA52_RS26155 (QKA52_26155) | 5574695..5575000 | - | 306 | WP_003111575.1 | HigA family addiction module antitoxin | Antitoxin |
| QKA52_RS26160 (QKA52_26160) | 5575012..5575290 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QKA52_RS26165 (QKA52_26165) | 5575343..5575471 | - | 129 | Protein_5171 | integrase | - |
| QKA52_RS26170 (QKA52_26170) | 5575619..5577847 | + | 2229 | WP_003099265.1 | TonB-dependent receptor | - |
| QKA52_RS26175 (QKA52_26175) | 5577917..5578564 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
| QKA52_RS26180 (QKA52_26180) | 5578626..5579864 | - | 1239 | WP_014603324.1 | C69 family dipeptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T281045 WP_003113526.1 NZ_CP124667:c5575290-5575012 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V6ALY3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0S3KUN4 |