Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 5456471..5457066 | Replicon | chromosome |
| Accession | NZ_CP124666 | ||
| Organism | Pseudomonas aeruginosa strain 2021CK-01283 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | V6ALY3 |
| Locus tag | QJ983_RS25410 | Protein ID | WP_003113526.1 |
| Coordinates | 5456788..5457066 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A0S3KUN4 |
| Locus tag | QJ983_RS25405 | Protein ID | WP_003111575.1 |
| Coordinates | 5456471..5456776 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJ983_RS25380 (QJ983_25380) | 5451483..5451755 | - | 273 | WP_003115921.1 | hypothetical protein | - |
| QJ983_RS25385 (QJ983_25385) | 5452530..5454416 | + | 1887 | WP_071550095.1 | ATP-binding protein | - |
| QJ983_RS25390 (QJ983_25390) | 5454595..5454867 | + | 273 | WP_071550096.1 | DNA-binding protein | - |
| QJ983_RS25395 (QJ983_25395) | 5454923..5455255 | + | 333 | WP_024947075.1 | hypothetical protein | - |
| QJ983_RS25400 (QJ983_25400) | 5455515..5456129 | + | 615 | WP_123794473.1 | hypothetical protein | - |
| QJ983_RS25405 (QJ983_25405) | 5456471..5456776 | - | 306 | WP_003111575.1 | HigA family addiction module antitoxin | Antitoxin |
| QJ983_RS25410 (QJ983_25410) | 5456788..5457066 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QJ983_RS25415 (QJ983_25415) | 5457119..5457247 | - | 129 | Protein_5020 | integrase | - |
| QJ983_RS25420 (QJ983_25420) | 5457395..5459623 | + | 2229 | WP_031686603.1 | TonB-dependent receptor | - |
| QJ983_RS25425 (QJ983_25425) | 5459694..5460341 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
| QJ983_RS25430 (QJ983_25430) | 5460403..5461641 | - | 1239 | WP_031686604.1 | C69 family dipeptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T281037 WP_003113526.1 NZ_CP124666:c5457066-5456788 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V6ALY3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0S3KUN4 |