Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 5441458..5442053 | Replicon | chromosome |
Accession | NZ_CP124665 | ||
Organism | Pseudomonas aeruginosa strain 2021CK-01229 |
Toxin (Protein)
Gene name | higB | Uniprot ID | V6ALY3 |
Locus tag | QJ956_RS25290 | Protein ID | WP_003113526.1 |
Coordinates | 5441775..5442053 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A0S3KUN4 |
Locus tag | QJ956_RS25285 | Protein ID | WP_003111575.1 |
Coordinates | 5441458..5441763 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJ956_RS25260 (QJ956_25260) | 5436470..5436742 | - | 273 | WP_003115921.1 | hypothetical protein | - |
QJ956_RS25265 (QJ956_25265) | 5437517..5439403 | + | 1887 | WP_071550095.1 | ATP-binding protein | - |
QJ956_RS25270 (QJ956_25270) | 5439582..5439854 | + | 273 | WP_071550096.1 | DNA-binding protein | - |
QJ956_RS25275 (QJ956_25275) | 5439910..5440242 | + | 333 | WP_024947075.1 | hypothetical protein | - |
QJ956_RS25280 (QJ956_25280) | 5440502..5441116 | + | 615 | WP_123794473.1 | hypothetical protein | - |
QJ956_RS25285 (QJ956_25285) | 5441458..5441763 | - | 306 | WP_003111575.1 | HigA family addiction module antitoxin | Antitoxin |
QJ956_RS25290 (QJ956_25290) | 5441775..5442053 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QJ956_RS25295 (QJ956_25295) | 5442106..5442234 | - | 129 | Protein_4996 | integrase | - |
QJ956_RS25300 (QJ956_25300) | 5442382..5444610 | + | 2229 | WP_031686603.1 | TonB-dependent receptor | - |
QJ956_RS25305 (QJ956_25305) | 5444681..5445328 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
QJ956_RS25310 (QJ956_25310) | 5445390..5446628 | - | 1239 | WP_031686604.1 | C69 family dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T281031 WP_003113526.1 NZ_CP124665:c5442053-5441775 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V6ALY3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0S3KUN4 |