Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 5522418..5523013 | Replicon | chromosome |
Accession | NZ_CP124664 | ||
Organism | Pseudomonas aeruginosa strain 2021CK-01256 |
Toxin (Protein)
Gene name | higB | Uniprot ID | V6ALY3 |
Locus tag | QJ960_RS25715 | Protein ID | WP_003113526.1 |
Coordinates | 5522735..5523013 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QJ960_RS25710 | Protein ID | WP_003113527.1 |
Coordinates | 5522418..5522723 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJ960_RS25690 (QJ960_25690) | 5518494..5518751 | + | 258 | WP_010793759.1 | ATP-binding protein | - |
QJ960_RS25695 (QJ960_25695) | 5519127..5519990 | - | 864 | WP_010793758.1 | integrase domain-containing protein | - |
QJ960_RS25700 (QJ960_25700) | 5520592..5521734 | - | 1143 | WP_010793757.1 | STY4528 family pathogenicity island replication protein | - |
QJ960_RS25710 (QJ960_25710) | 5522418..5522723 | - | 306 | WP_003113527.1 | HigA family addiction module antitoxin | Antitoxin |
QJ960_RS25715 (QJ960_25715) | 5522735..5523013 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QJ960_RS25720 (QJ960_25720) | 5523066..5523194 | - | 129 | Protein_5081 | integrase | - |
QJ960_RS25725 (QJ960_25725) | 5523342..5525570 | + | 2229 | WP_003099265.1 | TonB-dependent receptor | - |
QJ960_RS25730 (QJ960_25730) | 5525640..5526287 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
QJ960_RS25735 (QJ960_25735) | 5526349..5527587 | - | 1239 | WP_010793756.1 | C69 family dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T281025 WP_003113526.1 NZ_CP124664:c5523013-5522735 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|