Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 4755629..4756310 | Replicon | chromosome |
Accession | NZ_CP124664 | ||
Organism | Pseudomonas aeruginosa strain 2021CK-01256 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | QJ960_RS22155 | Protein ID | WP_034017891.1 |
Coordinates | 4755945..4756310 (-) | Length | 122 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QJ960_RS22150 | Protein ID | WP_003145733.1 |
Coordinates | 4755629..4755952 (-) | Length | 108 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJ960_RS22125 (QJ960_22125) | 4751542..4752180 | + | 639 | WP_003140882.1 | hypothetical protein | - |
QJ960_RS22130 (QJ960_22130) | 4752423..4752758 | + | 336 | WP_003119438.1 | TM2 domain-containing protein | - |
QJ960_RS22135 (QJ960_22135) | 4752932..4753450 | + | 519 | WP_010793873.1 | PAAR domain-containing protein | - |
QJ960_RS22140 (QJ960_22140) | 4753447..4754148 | + | 702 | WP_121410759.1 | VRR-NUC domain-containing protein | - |
QJ960_RS22145 (QJ960_22145) | 4754165..4755253 | + | 1089 | WP_034047786.1 | DUF3396 domain-containing protein | - |
QJ960_RS22150 (QJ960_22150) | 4755629..4755952 | - | 324 | WP_003145733.1 | XRE family transcriptional regulator | Antitoxin |
QJ960_RS22155 (QJ960_22155) | 4755945..4756310 | - | 366 | WP_034017891.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QJ960_RS22160 (QJ960_22160) | 4756603..4756887 | - | 285 | WP_034047788.1 | hypothetical protein | - |
QJ960_RS22165 (QJ960_22165) | 4757051..4757323 | + | 273 | WP_282415342.1 | hypothetical protein | - |
QJ960_RS22170 (QJ960_22170) | 4757342..4757767 | - | 426 | WP_003085665.1 | VOC family protein | - |
QJ960_RS22175 (QJ960_22175) | 4757868..4758752 | + | 885 | WP_023084912.1 | LysR family transcriptional regulator | - |
QJ960_RS22180 (QJ960_22180) | 4758725..4759678 | - | 954 | WP_003085661.1 | LysR substrate-binding domain-containing protein | - |
QJ960_RS22185 (QJ960_22185) | 4759899..4760333 | + | 435 | WP_016253806.1 | RidA family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 4741510..4758752 | 17242 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 13824.22 Da Isoelectric Point: 4.9715
>T281023 WP_034017891.1 NZ_CP124664:c4756310-4755945 [Pseudomonas aeruginosa]
VAWDIEYTDEFGDWWGSLSEDEQESLAVTVRLLEERGPSLGHLHSSGINGSRHGHMRELRTQHGGRPFRTLYAFDPRRSA
ILLIGGDKTGDDRWYELNVPIADRLYDEHLHQLREGGLIDG
VAWDIEYTDEFGDWWGSLSEDEQESLAVTVRLLEERGPSLGHLHSSGINGSRHGHMRELRTQHGGRPFRTLYAFDPRRSA
ILLIGGDKTGDDRWYELNVPIADRLYDEHLHQLREGGLIDG
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|