Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
| Location | 1211938..1212560 | Replicon | chromosome |
| Accession | NZ_CP124664 | ||
| Organism | Pseudomonas aeruginosa strain 2021CK-01256 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | QJ960_RS05675 | Protein ID | WP_023910260.1 |
| Coordinates | 1211938..1212252 (+) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QJ960_RS05680 | Protein ID | WP_023910258.1 |
| Coordinates | 1212255..1212560 (+) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJ960_RS05645 (QJ960_05645) | 1208106..1209062 | + | 957 | WP_228778151.1 | site-specific integrase | - |
| QJ960_RS05650 (QJ960_05650) | 1209131..1209442 | + | 312 | WP_031631670.1 | outer membrane protein assembly factor BamE | - |
| QJ960_RS05655 (QJ960_05655) | 1209561..1210211 | + | 651 | WP_023910263.1 | BRCT domain-containing protein | - |
| QJ960_RS05660 (QJ960_05660) | 1210576..1210788 | + | 213 | WP_034004326.1 | hypothetical protein | - |
| QJ960_RS05665 (QJ960_05665) | 1210760..1211359 | + | 600 | WP_126610319.1 | DUF2335 domain-containing protein | - |
| QJ960_RS05670 (QJ960_05670) | 1211594..1211941 | + | 348 | WP_282415384.1 | hypothetical protein | - |
| QJ960_RS05675 (QJ960_05675) | 1211938..1212252 | + | 315 | WP_023910260.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QJ960_RS05680 (QJ960_05680) | 1212255..1212560 | + | 306 | WP_023910258.1 | helix-turn-helix domain-containing protein | Antitoxin |
| QJ960_RS05685 (QJ960_05685) | 1212621..1212923 | - | 303 | WP_031275114.1 | hypothetical protein | - |
| QJ960_RS05690 (QJ960_05690) | 1212920..1213261 | - | 342 | WP_282415385.1 | hypothetical protein | - |
| QJ960_RS05695 (QJ960_05695) | 1213266..1213955 | - | 690 | WP_003129605.1 | hypothetical protein | - |
| QJ960_RS05700 (QJ960_05700) | 1214128..1214319 | - | 192 | WP_010792000.1 | hypothetical protein | - |
| QJ960_RS05705 (QJ960_05705) | 1214432..1215094 | - | 663 | WP_058171377.1 | hypothetical protein | - |
| QJ960_RS05710 (QJ960_05710) | 1215091..1215426 | - | 336 | WP_033987586.1 | hypothetical protein | - |
| QJ960_RS05715 (QJ960_05715) | 1215429..1215659 | - | 231 | WP_023123494.1 | Arc family DNA-binding protein | - |
| QJ960_RS05720 (QJ960_05720) | 1215757..1215990 | - | 234 | WP_023086948.1 | hypothetical protein | - |
| QJ960_RS05725 (QJ960_05725) | 1215993..1216379 | - | 387 | WP_023086949.1 | helix-turn-helix transcriptional regulator | - |
| QJ960_RS05730 (QJ960_05730) | 1216792..1217268 | - | 477 | WP_126610311.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1205018..1257000 | 51982 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11776.54 Da Isoelectric Point: 9.4385
>T281019 WP_023910260.1 NZ_CP124664:1211938-1212252 [Pseudomonas aeruginosa]
MIFIETPVFTKRILALVDDETYRKLQEDLTLHPDAGVVIEGTGGVRKIRIAANGHGKRGGARVIYYHFTSASQIAFLLAY
DKASQEDLTADQKKMLRQIVENWR
MIFIETPVFTKRILALVDDETYRKLQEDLTLHPDAGVVIEGTGGVRKIRIAANGHGKRGGARVIYYHFTSASQIAFLLAY
DKASQEDLTADQKKMLRQIVENWR
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|