Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/RelE-HTH
Location 1211938..1212560 Replicon chromosome
Accession NZ_CP124664
Organism Pseudomonas aeruginosa strain 2021CK-01256

Toxin (Protein)


Gene name higB Uniprot ID -
Locus tag QJ960_RS05675 Protein ID WP_023910260.1
Coordinates 1211938..1212252 (+) Length 105 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag QJ960_RS05680 Protein ID WP_023910258.1
Coordinates 1212255..1212560 (+) Length 102 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJ960_RS05645 (QJ960_05645) 1208106..1209062 + 957 WP_228778151.1 site-specific integrase -
QJ960_RS05650 (QJ960_05650) 1209131..1209442 + 312 WP_031631670.1 outer membrane protein assembly factor BamE -
QJ960_RS05655 (QJ960_05655) 1209561..1210211 + 651 WP_023910263.1 BRCT domain-containing protein -
QJ960_RS05660 (QJ960_05660) 1210576..1210788 + 213 WP_034004326.1 hypothetical protein -
QJ960_RS05665 (QJ960_05665) 1210760..1211359 + 600 WP_126610319.1 DUF2335 domain-containing protein -
QJ960_RS05670 (QJ960_05670) 1211594..1211941 + 348 WP_282415384.1 hypothetical protein -
QJ960_RS05675 (QJ960_05675) 1211938..1212252 + 315 WP_023910260.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QJ960_RS05680 (QJ960_05680) 1212255..1212560 + 306 WP_023910258.1 helix-turn-helix domain-containing protein Antitoxin
QJ960_RS05685 (QJ960_05685) 1212621..1212923 - 303 WP_031275114.1 hypothetical protein -
QJ960_RS05690 (QJ960_05690) 1212920..1213261 - 342 WP_282415385.1 hypothetical protein -
QJ960_RS05695 (QJ960_05695) 1213266..1213955 - 690 WP_003129605.1 hypothetical protein -
QJ960_RS05700 (QJ960_05700) 1214128..1214319 - 192 WP_010792000.1 hypothetical protein -
QJ960_RS05705 (QJ960_05705) 1214432..1215094 - 663 WP_058171377.1 hypothetical protein -
QJ960_RS05710 (QJ960_05710) 1215091..1215426 - 336 WP_033987586.1 hypothetical protein -
QJ960_RS05715 (QJ960_05715) 1215429..1215659 - 231 WP_023123494.1 Arc family DNA-binding protein -
QJ960_RS05720 (QJ960_05720) 1215757..1215990 - 234 WP_023086948.1 hypothetical protein -
QJ960_RS05725 (QJ960_05725) 1215993..1216379 - 387 WP_023086949.1 helix-turn-helix transcriptional regulator -
QJ960_RS05730 (QJ960_05730) 1216792..1217268 - 477 WP_126610311.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1205018..1257000 51982


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-2

(43-101)

Antitoxin

Cro/C1-type helix-turn-helix domain

(36-72)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11776.54 Da        Isoelectric Point: 9.4385

>T281019 WP_023910260.1 NZ_CP124664:1211938-1212252 [Pseudomonas aeruginosa]
MIFIETPVFTKRILALVDDETYRKLQEDLTLHPDAGVVIEGTGGVRKIRIAANGHGKRGGARVIYYHFTSASQIAFLLAY
DKASQEDLTADQKKMLRQIVENWR

Download         Length: 315 bp

Antitoxin


Download         Length: 102 a.a.        Molecular weight: 11316.84 Da        Isoelectric Point: 7.2077

>AT281019 WP_023910258.1 NZ_CP124664:1212255-1212560 [Pseudomonas aeruginosa]
MDKELFAELVESVTQMDEIVRGERQPSREFHVDAVKVKEIRRATGLSQAKFARKIDVAVGTLRNWEQGRRDPEGPARALL
RAIDNDPVHVLAALNGGPRES

Download         Length: 306 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References