Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 6057522..6058117 | Replicon | chromosome |
Accession | NZ_CP124662 | ||
Organism | Pseudomonas aeruginosa strain 2021CK-01633 |
Toxin (Protein)
Gene name | higB | Uniprot ID | V6ALY3 |
Locus tag | P7I91_RS28745 | Protein ID | WP_003113526.1 |
Coordinates | 6057839..6058117 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A0S3KUN4 |
Locus tag | P7I91_RS28740 | Protein ID | WP_003111575.1 |
Coordinates | 6057522..6057827 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P7I91_RS28705 (P7I91_28705) | 6052662..6053510 | + | 849 | WP_023096155.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
P7I91_RS28715 (P7I91_28715) | 6053677..6054618 | + | 942 | WP_003099281.1 | ribose-phosphate pyrophosphokinase | - |
P7I91_RS28720 (P7I91_28720) | 6054735..6055349 | + | 615 | WP_003095013.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
P7I91_RS28725 (P7I91_28725) | 6055391..6055975 | + | 585 | WP_003099278.1 | aminoacyl-tRNA hydrolase | - |
P7I91_RS28730 (P7I91_28730) | 6056016..6057116 | + | 1101 | WP_003099270.1 | redox-regulated ATPase YchF | - |
P7I91_RS28740 (P7I91_28740) | 6057522..6057827 | - | 306 | WP_003111575.1 | HigA family addiction module antitoxin | Antitoxin |
P7I91_RS28745 (P7I91_28745) | 6057839..6058117 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P7I91_RS28750 (P7I91_28750) | 6058170..6058298 | - | 129 | Protein_5689 | integrase | - |
P7I91_RS28755 (P7I91_28755) | 6058446..6060674 | + | 2229 | WP_021264080.1 | TonB-dependent receptor | - |
P7I91_RS28760 (P7I91_28760) | 6060744..6061391 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
P7I91_RS28765 (P7I91_28765) | 6061453..6062691 | - | 1239 | WP_014603324.1 | C69 family dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T281011 WP_003113526.1 NZ_CP124662:c6058117-6057839 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V6ALY3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0S3KUN4 |