Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 6050167..6050762 | Replicon | chromosome |
Accession | NZ_CP124660 | ||
Organism | Pseudomonas aeruginosa strain 2022CK-00160 |
Toxin (Protein)
Gene name | higB | Uniprot ID | V6ALY3 |
Locus tag | P7I96_RS28640 | Protein ID | WP_003113526.1 |
Coordinates | 6050484..6050762 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | P7I96_RS28635 | Protein ID | WP_003113527.1 |
Coordinates | 6050167..6050472 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P7I96_RS28600 (P7I96_28600) | 6045306..6046154 | + | 849 | WP_043106209.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
P7I96_RS28610 (P7I96_28610) | 6046321..6047262 | + | 942 | WP_003099281.1 | ribose-phosphate pyrophosphokinase | - |
P7I96_RS28615 (P7I96_28615) | 6047379..6047993 | + | 615 | WP_003099279.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
P7I96_RS28620 (P7I96_28620) | 6048035..6048619 | + | 585 | WP_003099278.1 | aminoacyl-tRNA hydrolase | - |
P7I96_RS28625 (P7I96_28625) | 6048660..6049760 | + | 1101 | WP_003099270.1 | redox-regulated ATPase YchF | - |
P7I96_RS28635 (P7I96_28635) | 6050167..6050472 | - | 306 | WP_003113527.1 | HigA family addiction module antitoxin | Antitoxin |
P7I96_RS28640 (P7I96_28640) | 6050484..6050762 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P7I96_RS28645 (P7I96_28645) | 6050815..6050943 | - | 129 | Protein_5664 | integrase | - |
P7I96_RS28650 (P7I96_28650) | 6051091..6053319 | + | 2229 | WP_023086667.1 | TonB-dependent receptor | - |
P7I96_RS28655 (P7I96_28655) | 6053389..6054036 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
P7I96_RS28660 (P7I96_28660) | 6054098..6055336 | - | 1239 | WP_003113524.1 | dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T281002 WP_003113526.1 NZ_CP124660:c6050762-6050484 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|