Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 5845971..5846566 | Replicon | chromosome |
Accession | NZ_CP124658 | ||
Organism | Pseudomonas aeruginosa strain 2022CK-00068 |
Toxin (Protein)
Gene name | higB | Uniprot ID | V6ALY3 |
Locus tag | P7I93_RS27930 | Protein ID | WP_003113526.1 |
Coordinates | 5846288..5846566 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A0S3KUN4 |
Locus tag | P7I93_RS27925 | Protein ID | WP_003111575.1 |
Coordinates | 5845971..5846276 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P7I93_RS27890 (P7I93_27890) | 5841123..5841971 | + | 849 | WP_023092961.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
P7I93_RS27900 (P7I93_27900) | 5842138..5843079 | + | 942 | WP_003099281.1 | ribose-phosphate pyrophosphokinase | - |
P7I93_RS27905 (P7I93_27905) | 5843196..5843810 | + | 615 | WP_003095013.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
P7I93_RS27910 (P7I93_27910) | 5843852..5844436 | + | 585 | WP_003099278.1 | aminoacyl-tRNA hydrolase | - |
P7I93_RS27915 (P7I93_27915) | 5844477..5845577 | + | 1101 | WP_003099270.1 | redox-regulated ATPase YchF | - |
P7I93_RS27925 (P7I93_27925) | 5845971..5846276 | - | 306 | WP_003111575.1 | HigA family addiction module antitoxin | Antitoxin |
P7I93_RS27930 (P7I93_27930) | 5846288..5846566 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P7I93_RS27935 (P7I93_27935) | 5846619..5846747 | - | 129 | Protein_5519 | integrase | - |
P7I93_RS27940 (P7I93_27940) | 5846895..5849123 | + | 2229 | WP_021264080.1 | TonB-dependent receptor | - |
P7I93_RS27945 (P7I93_27945) | 5849193..5849840 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
P7I93_RS27950 (P7I93_27950) | 5849902..5851140 | - | 1239 | WP_023092962.1 | C69 family dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T280994 WP_003113526.1 NZ_CP124658:c5846566-5846288 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V6ALY3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0S3KUN4 |