Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 5814455..5815050 | Replicon | chromosome |
Accession | NZ_CP124657 | ||
Organism | Pseudomonas aeruginosa strain 2022CK-00069 |
Toxin (Protein)
Gene name | higB | Uniprot ID | V6ALY3 |
Locus tag | P7I94_RS28025 | Protein ID | WP_003113526.1 |
Coordinates | 5814772..5815050 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A0S3KUN4 |
Locus tag | P7I94_RS28020 | Protein ID | WP_003111575.1 |
Coordinates | 5814455..5814760 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P7I94_RS27985 (P7I94_27990) | 5809595..5810443 | + | 849 | WP_023096155.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
P7I94_RS27995 (P7I94_28000) | 5810610..5811551 | + | 942 | WP_003099281.1 | ribose-phosphate pyrophosphokinase | - |
P7I94_RS28000 (P7I94_28005) | 5811668..5812282 | + | 615 | WP_003095013.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
P7I94_RS28005 (P7I94_28010) | 5812324..5812908 | + | 585 | WP_003099278.1 | aminoacyl-tRNA hydrolase | - |
P7I94_RS28010 (P7I94_28015) | 5812949..5814049 | + | 1101 | WP_003099270.1 | redox-regulated ATPase YchF | - |
P7I94_RS28020 (P7I94_28025) | 5814455..5814760 | - | 306 | WP_003111575.1 | HigA family addiction module antitoxin | Antitoxin |
P7I94_RS28025 (P7I94_28030) | 5814772..5815050 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P7I94_RS28030 (P7I94_28035) | 5815103..5815231 | - | 129 | Protein_5453 | integrase | - |
P7I94_RS28035 (P7I94_28040) | 5815379..5817607 | + | 2229 | WP_021264080.1 | TonB-dependent receptor | - |
P7I94_RS28040 (P7I94_28045) | 5817677..5818324 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
P7I94_RS28045 (P7I94_28050) | 5818386..5819624 | - | 1239 | WP_014603324.1 | C69 family dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T280986 WP_003113526.1 NZ_CP124657:c5815050-5814772 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V6ALY3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0S3KUN4 |