Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 1212113..1212708 | Replicon | chromosome |
| Accession | NZ_CP124655 | ||
| Organism | Pseudomonas aeruginosa strain 2022CK-00096 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | V6ALY3 |
| Locus tag | P7I95_RS05645 | Protein ID | WP_003113526.1 |
| Coordinates | 1212113..1212391 (+) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A0S3KUN4 |
| Locus tag | P7I95_RS05650 | Protein ID | WP_003111575.1 |
| Coordinates | 1212403..1212708 (+) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P7I95_RS05625 (P7I95_05625) | 1207539..1208777 | + | 1239 | WP_014603324.1 | C69 family dipeptidase | - |
| P7I95_RS05630 (P7I95_05630) | 1208839..1209486 | + | 648 | WP_003095021.1 | carbonate dehydratase | - |
| P7I95_RS05635 (P7I95_05635) | 1209556..1211784 | - | 2229 | WP_021264080.1 | TonB-dependent receptor | - |
| P7I95_RS05640 (P7I95_05640) | 1211932..1212060 | + | 129 | Protein_1109 | integrase | - |
| P7I95_RS05645 (P7I95_05645) | 1212113..1212391 | + | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| P7I95_RS05650 (P7I95_05650) | 1212403..1212708 | + | 306 | WP_003111575.1 | HigA family addiction module antitoxin | Antitoxin |
| P7I95_RS05660 (P7I95_05660) | 1213114..1214214 | - | 1101 | WP_003099270.1 | redox-regulated ATPase YchF | - |
| P7I95_RS05665 (P7I95_05665) | 1214255..1214839 | - | 585 | WP_003099278.1 | aminoacyl-tRNA hydrolase | - |
| P7I95_RS05670 (P7I95_05670) | 1214881..1215495 | - | 615 | WP_003095013.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
| P7I95_RS05675 (P7I95_05675) | 1215612..1216553 | - | 942 | WP_003099281.1 | ribose-phosphate pyrophosphokinase | - |
| P7I95_RS05685 (P7I95_05685) | 1216720..1217568 | - | 849 | WP_023096155.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T280973 WP_003113526.1 NZ_CP124655:1212113-1212391 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V6ALY3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0S3KUN4 |