Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 5416982..5417577 | Replicon | chromosome |
| Accession | NZ_CP124654 | ||
| Organism | Pseudomonas aeruginosa strain 2021CK-01851 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | V6ALY3 |
| Locus tag | P7I92_RS25270 | Protein ID | WP_003113526.1 |
| Coordinates | 5417299..5417577 (-) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | P7I92_RS25265 | Protein ID | WP_003133769.1 |
| Coordinates | 5416982..5417287 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P7I92_RS25235 (P7I92_25235) | 5412436..5412726 | - | 291 | WP_023083237.1 | DUF5447 family protein | - |
| P7I92_RS25240 (P7I92_25240) | 5412938..5413210 | - | 273 | WP_003115921.1 | hypothetical protein | - |
| P7I92_RS25245 (P7I92_25245) | 5413320..5413586 | + | 267 | WP_016852153.1 | hypothetical protein | - |
| P7I92_RS25250 (P7I92_25250) | 5413718..5414554 | + | 837 | WP_223656480.1 | helix-turn-helix domain-containing protein | - |
| P7I92_RS25255 (P7I92_25255) | 5414529..5416067 | + | 1539 | WP_079759796.1 | GNAT family N-acetyltransferase | - |
| P7I92_RS25260 (P7I92_25260) | 5416079..5416606 | - | 528 | WP_071535723.1 | ATP-binding protein | - |
| P7I92_RS25265 (P7I92_25265) | 5416982..5417287 | - | 306 | WP_003133769.1 | HigA family addiction module antitoxin | Antitoxin |
| P7I92_RS25270 (P7I92_25270) | 5417299..5417577 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| P7I92_RS25275 (P7I92_25275) | 5417630..5417758 | - | 129 | Protein_4992 | integrase | - |
| P7I92_RS25280 (P7I92_25280) | 5417906..5420134 | + | 2229 | WP_282415098.1 | TonB-dependent receptor | - |
| P7I92_RS25285 (P7I92_25285) | 5420204..5420851 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
| P7I92_RS25290 (P7I92_25290) | 5420913..5422151 | - | 1239 | WP_003111578.1 | C69 family dipeptidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T280972 WP_003113526.1 NZ_CP124654:c5417577-5417299 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|