Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 1190849..1191444 | Replicon | chromosome |
| Accession | NZ_CP124652 | ||
| Organism | Pseudomonas aeruginosa strain 2020CK-00443 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | V6ALY3 |
| Locus tag | P7I82_RS05495 | Protein ID | WP_003113526.1 |
| Coordinates | 1190849..1191127 (+) | Length | 93 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A0S3KUN4 |
| Locus tag | P7I82_RS05500 | Protein ID | WP_003111575.1 |
| Coordinates | 1191139..1191444 (+) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P7I82_RS05475 (P7I82_05475) | 1186275..1187513 | + | 1239 | WP_014603324.1 | C69 family dipeptidase | - |
| P7I82_RS05480 (P7I82_05480) | 1187575..1188222 | + | 648 | WP_003095021.1 | carbonate dehydratase | - |
| P7I82_RS05485 (P7I82_05485) | 1188292..1190520 | - | 2229 | WP_021264080.1 | TonB-dependent receptor | - |
| P7I82_RS05490 (P7I82_05490) | 1190668..1190796 | + | 129 | Protein_1079 | integrase | - |
| P7I82_RS05495 (P7I82_05495) | 1190849..1191127 | + | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| P7I82_RS05500 (P7I82_05500) | 1191139..1191444 | + | 306 | WP_003111575.1 | HigA family addiction module antitoxin | Antitoxin |
| P7I82_RS05510 (P7I82_05510) | 1191850..1192950 | - | 1101 | WP_003099270.1 | redox-regulated ATPase YchF | - |
| P7I82_RS05515 (P7I82_05515) | 1192991..1193575 | - | 585 | WP_003099278.1 | aminoacyl-tRNA hydrolase | - |
| P7I82_RS05520 (P7I82_05520) | 1193617..1194231 | - | 615 | WP_003095013.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
| P7I82_RS05525 (P7I82_05525) | 1194348..1195289 | - | 942 | WP_003099281.1 | ribose-phosphate pyrophosphokinase | - |
| P7I82_RS05535 (P7I82_05535) | 1195456..1196304 | - | 849 | WP_023096155.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T280960 WP_003113526.1 NZ_CP124652:1190849-1191127 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V6ALY3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0S3KUN4 |