Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 1496349..1496944 | Replicon | chromosome |
Accession | NZ_CP124648 | ||
Organism | Pseudomonas aeruginosa strain 2020CK-00220 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A6N0KDU0 |
Locus tag | P7I81_RS07200 | Protein ID | WP_023436306.1 |
Coordinates | 1496666..1496944 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | P7I81_RS07195 | Protein ID | WP_003133769.1 |
Coordinates | 1496349..1496654 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P7I81_RS07175 (P7I81_07175) | 1491741..1492013 | - | 273 | WP_004352675.1 | hypothetical protein | - |
P7I81_RS07180 (P7I81_07180) | 1492123..1492389 | + | 267 | WP_023088595.1 | hypothetical protein | - |
P7I81_RS07185 (P7I81_07185) | 1492445..1492780 | + | 336 | WP_079862847.1 | hypothetical protein | - |
P7I81_RS07190 (P7I81_07190) | 1492895..1495354 | - | 2460 | WP_124089962.1 | SIR2 family protein | - |
P7I81_RS07195 (P7I81_07195) | 1496349..1496654 | - | 306 | WP_003133769.1 | HigA family addiction module antitoxin | Antitoxin |
P7I81_RS07200 (P7I81_07200) | 1496666..1496944 | - | 279 | WP_023436306.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P7I81_RS07205 (P7I81_07205) | 1496997..1497125 | - | 129 | Protein_1419 | integrase | - |
P7I81_RS07210 (P7I81_07210) | 1497273..1499501 | + | 2229 | WP_124089964.1 | TonB-dependent receptor | - |
P7I81_RS07215 (P7I81_07215) | 1499572..1500219 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
P7I81_RS07220 (P7I81_07220) | 1500281..1501519 | - | 1239 | WP_003095023.1 | C69 family dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10588.11 Da Isoelectric Point: 7.2451
>T280939 WP_023436306.1 NZ_CP124648:c1496944-1496666 [Pseudomonas aeruginosa]
MILTFRCDEARQLFETGLSRQWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDEARQLFETGLSRQWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|