Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 5802740..5803335 | Replicon | chromosome |
Accession | NZ_CP124646 | ||
Organism | Pseudomonas aeruginosa strain 2020CK-00185 |
Toxin (Protein)
Gene name | higB | Uniprot ID | V6ALY3 |
Locus tag | P7I78_RS27100 | Protein ID | WP_003113526.1 |
Coordinates | 5803057..5803335 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | P7I78_RS27095 | Protein ID | WP_003133769.1 |
Coordinates | 5802740..5803045 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P7I78_RS27060 (P7I78_27060) | 5797881..5798729 | + | 849 | WP_003095007.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
P7I78_RS27070 (P7I78_27070) | 5798896..5799837 | + | 942 | WP_003099281.1 | ribose-phosphate pyrophosphokinase | - |
P7I78_RS27075 (P7I78_27075) | 5799954..5800568 | + | 615 | WP_003095013.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
P7I78_RS27080 (P7I78_27080) | 5800610..5801194 | + | 585 | WP_003099278.1 | aminoacyl-tRNA hydrolase | - |
P7I78_RS27085 (P7I78_27085) | 5801235..5802335 | + | 1101 | WP_003099270.1 | redox-regulated ATPase YchF | - |
P7I78_RS27095 (P7I78_27095) | 5802740..5803045 | - | 306 | WP_003133769.1 | HigA family addiction module antitoxin | Antitoxin |
P7I78_RS27100 (P7I78_27100) | 5803057..5803335 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P7I78_RS27105 (P7I78_27105) | 5803388..5803516 | - | 129 | Protein_5356 | integrase | - |
P7I78_RS27110 (P7I78_27110) | 5803664..5805892 | + | 2229 | WP_003141628.1 | TonB-dependent receptor | - |
P7I78_RS27115 (P7I78_27115) | 5805962..5806609 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
P7I78_RS27120 (P7I78_27120) | 5806671..5807909 | - | 1239 | WP_003141631.1 | C69 family dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T280933 WP_003113526.1 NZ_CP124646:c5803335-5803057 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|