Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 5440946..5441541 | Replicon | chromosome |
Accession | NZ_CP124641 | ||
Organism | Pseudomonas aeruginosa strain 2021CK-01198 |
Toxin (Protein)
Gene name | higB | Uniprot ID | V6ALY3 |
Locus tag | P7I90_RS25350 | Protein ID | WP_003113526.1 |
Coordinates | 5441263..5441541 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A0S3KUN4 |
Locus tag | P7I90_RS25345 | Protein ID | WP_003111575.1 |
Coordinates | 5440946..5441251 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P7I90_RS25310 (P7I90_25310) | 5436089..5436238 | - | 150 | WP_282393435.1 | hypothetical protein | - |
P7I90_RS25315 (P7I90_25315) | 5436242..5436532 | - | 291 | WP_031627909.1 | DUF5447 family protein | - |
P7I90_RS25320 (P7I90_25320) | 5436744..5437016 | - | 273 | WP_003115921.1 | hypothetical protein | - |
P7I90_RS25325 (P7I90_25325) | 5437463..5437798 | + | 336 | WP_079382696.1 | hypothetical protein | - |
P7I90_RS25330 (P7I90_25330) | 5437857..5439005 | - | 1149 | WP_129377001.1 | beta family protein | - |
P7I90_RS25335 (P7I90_25335) | 5439007..5440218 | - | 1212 | WP_079382698.1 | ImmA/IrrE family metallo-endopeptidase | - |
P7I90_RS25340 (P7I90_25340) | 5440208..5440552 | - | 345 | WP_153570804.1 | type II toxin-antitoxin system HigB family toxin | - |
P7I90_RS25345 (P7I90_25345) | 5440946..5441251 | - | 306 | WP_003111575.1 | HigA family addiction module antitoxin | Antitoxin |
P7I90_RS25350 (P7I90_25350) | 5441263..5441541 | - | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P7I90_RS25355 (P7I90_25355) | 5441594..5441722 | - | 129 | Protein_5009 | integrase | - |
P7I90_RS25360 (P7I90_25360) | 5441870..5444098 | + | 2229 | WP_021264080.1 | TonB-dependent receptor | - |
P7I90_RS25365 (P7I90_25365) | 5444168..5444815 | - | 648 | WP_003095021.1 | carbonate dehydratase | - |
P7I90_RS25370 (P7I90_25370) | 5444877..5446115 | - | 1239 | WP_014603324.1 | C69 family dipeptidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T280925 WP_003113526.1 NZ_CP124641:c5441541-5441263 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V6ALY3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0S3KUN4 |