Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 2208748..2209343 | Replicon | chromosome |
Accession | NZ_CP124626 | ||
Organism | Pseudomonas aeruginosa strain 2021CK-01161 |
Toxin (Protein)
Gene name | higB | Uniprot ID | V6ALY3 |
Locus tag | P7I86_RS10370 | Protein ID | WP_003113526.1 |
Coordinates | 2208748..2209026 (+) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A0S3KUN4 |
Locus tag | P7I86_RS10375 | Protein ID | WP_003111575.1 |
Coordinates | 2209038..2209343 (+) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P7I86_RS10350 (P7I86_10350) | 2204174..2205412 | + | 1239 | WP_014603324.1 | C69 family dipeptidase | - |
P7I86_RS10355 (P7I86_10355) | 2205474..2206121 | + | 648 | WP_003095021.1 | carbonate dehydratase | - |
P7I86_RS10360 (P7I86_10360) | 2206191..2208419 | - | 2229 | WP_021264080.1 | TonB-dependent receptor | - |
P7I86_RS10365 (P7I86_10365) | 2208567..2208695 | + | 129 | Protein_2042 | integrase | - |
P7I86_RS10370 (P7I86_10370) | 2208748..2209026 | + | 279 | WP_003113526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
P7I86_RS10375 (P7I86_10375) | 2209038..2209343 | + | 306 | WP_003111575.1 | HigA family addiction module antitoxin | Antitoxin |
P7I86_RS10385 (P7I86_10385) | 2209749..2210849 | - | 1101 | WP_003099270.1 | redox-regulated ATPase YchF | - |
P7I86_RS10390 (P7I86_10390) | 2210890..2211474 | - | 585 | WP_003099278.1 | aminoacyl-tRNA hydrolase | - |
P7I86_RS10395 (P7I86_10395) | 2211516..2212130 | - | 615 | WP_003095013.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
P7I86_RS10400 (P7I86_10400) | 2212247..2213188 | - | 942 | WP_003099281.1 | ribose-phosphate pyrophosphokinase | - |
P7I86_RS10410 (P7I86_10410) | 2213355..2214203 | - | 849 | WP_023096155.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10646.19 Da Isoelectric Point: 7.8937
>T280894 WP_003113526.1 NZ_CP124626:2208748-2209026 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAATELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V6ALY3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0S3KUN4 |