Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 3811439..3812102 | Replicon | chromosome |
Accession | NZ_CP124548 | ||
Organism | Actinomyces israelii strain F0345 |
Toxin (Protein)
Gene name | HigB2 | Uniprot ID | - |
Locus tag | AIF0345_RS15835 | Protein ID | WP_285296679.1 |
Coordinates | 3811439..3811804 (+) | Length | 122 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | AIF0345_RS15840 | Protein ID | WP_285296680.1 |
Coordinates | 3811788..3812102 (+) | Length | 105 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AIF0345_RS15820 | 3807520..3808554 | + | 1035 | WP_285296676.1 | alpha/beta hydrolase-fold protein | - |
AIF0345_RS15825 | 3809542..3811122 | + | 1581 | WP_285296677.1 | ATP-binding protein | - |
AIF0345_RS15830 | 3811086..3811262 | + | 177 | WP_285296678.1 | helix-turn-helix domain-containing protein | - |
AIF0345_RS15835 | 3811439..3811804 | + | 366 | WP_285296679.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
AIF0345_RS15840 | 3811788..3812102 | + | 315 | WP_285296680.1 | XRE family transcriptional regulator | Antitoxin |
AIF0345_RS15845 | 3812313..3813800 | - | 1488 | WP_084682631.1 | sugar porter family MFS transporter | - |
AIF0345_RS15850 | 3814056..3814943 | - | 888 | WP_285296681.1 | hypothetical protein | - |
AIF0345_RS15855 | 3815282..3816448 | - | 1167 | WP_285296682.1 | ISAs1 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 3811439..3824531 | 13092 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 14055.84 Da Isoelectric Point: 4.6456
>T280856 WP_285296679.1 NZ_CP124548:3811439-3811804 [Actinomyces israelii]
VAWEVILWEDVESWLLSLDDVSYDLVAAAIDHLAAVGPTLGRPLVDLLIGSHYHNLKELRPGSSERSEIRILFAFDSRRR
AVLLIAGDKRGRWQQWYRESIPLAELRFDQWLRESNNDENE
VAWEVILWEDVESWLLSLDDVSYDLVAAAIDHLAAVGPTLGRPLVDLLIGSHYHNLKELRPGSSERSEIRILFAFDSRRR
AVLLIAGDKRGRWQQWYRESIPLAELRFDQWLRESNNDENE
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|