Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4496464..4497218 | Replicon | chromosome |
| Accession | NZ_CP124522 | ||
| Organism | Salmonella enterica strain PNUSAS118467 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5RFE2 |
| Locus tag | QJS74_RS21830 | Protein ID | WP_000558168.1 |
| Coordinates | 4496464..4496775 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QJS74_RS21835 | Protein ID | WP_001259009.1 |
| Coordinates | 4496772..4497218 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJS74_RS21800 (4492122) | 4492122..4493024 | + | 903 | WP_000331364.1 | formate dehydrogenase subunit beta | - |
| QJS74_RS21805 (4493021) | 4493021..4493656 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| QJS74_RS21810 (4493653) | 4493653..4494582 | + | 930 | WP_000027736.1 | formate dehydrogenase accessory protein FdhE | - |
| QJS74_RS21815 (4494629) | 4494629..4494919 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| QJS74_RS21820 (4494920) | 4494920..4495231 | - | 312 | WP_001159635.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| QJS74_RS21825 (4495449) | 4495449..4496378 | + | 930 | WP_001127705.1 | alpha/beta hydrolase | - |
| QJS74_RS21830 (4496464) | 4496464..4496775 | + | 312 | WP_000558168.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| QJS74_RS21835 (4496772) | 4496772..4497218 | + | 447 | WP_001259009.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| QJS74_RS21840 (4497233) | 4497233..4498174 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| QJS74_RS21845 (4498219) | 4498219..4498656 | - | 438 | WP_000560968.1 | D-aminoacyl-tRNA deacylase | - |
| QJS74_RS21850 (4498653) | 4498653..4499525 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| QJS74_RS21855 (4499519) | 4499519..4500118 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| QJS74_RS21860 (4500309) | 4500309..4501112 | - | 804 | WP_000059693.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| QJS74_RS21865 (4501146) | 4501146..4502042 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12324.26 Da Isoelectric Point: 9.3143
>T280829 WP_000558168.1 NZ_CP124522:4496464-4496775 [Salmonella enterica]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTLTQPEEMKRYIPSLDNFKHRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYDRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTLTQPEEMKRYIPSLDNFKHRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYDRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16720.06 Da Isoelectric Point: 6.6451
>AT280829 WP_001259009.1 NZ_CP124522:4496772-4497218 [Salmonella enterica]
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKSVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|