Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 66043..66282 | Replicon | plasmid pAVS0343-A |
| Accession | NZ_CP124518 | ||
| Organism | Escherichia coli strain AVS0343 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | A0A762TWR7 |
| Locus tag | QJB09_RS24950 | Protein ID | WP_023144756.1 |
| Coordinates | 66043..66177 (-) | Length | 45 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 66222..66282 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJB09_RS24915 (61390) | 61390..61805 | - | 416 | Protein_73 | IS1-like element IS1B family transposase | - |
| QJB09_RS24920 (62054) | 62054..62455 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| QJB09_RS24925 (62388) | 62388..62645 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| QJB09_RS24930 (62738) | 62738..63391 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| QJB09_RS24935 (64331) | 64331..65188 | - | 858 | WP_001617855.1 | incFII family plasmid replication initiator RepA | - |
| QJB09_RS24940 (65181) | 65181..65255 | - | 75 | WP_031943482.1 | RepA leader peptide Tap | - |
| QJB09_RS24945 (65492) | 65492..65746 | - | 255 | WP_000083850.1 | replication regulatory protein RepA | - |
| QJB09_RS24950 (66043) | 66043..66177 | - | 135 | WP_023144756.1 | Hok/Gef family protein | Toxin |
| - (66222) | 66222..66282 | + | 61 | NuclAT_1 | - | Antitoxin |
| - (66222) | 66222..66282 | + | 61 | NuclAT_1 | - | Antitoxin |
| - (66222) | 66222..66282 | + | 61 | NuclAT_1 | - | Antitoxin |
| - (66222) | 66222..66282 | + | 61 | NuclAT_1 | - | Antitoxin |
| QJB09_RS24955 (66249) | 66249..66535 | - | 287 | Protein_81 | DUF2726 domain-containing protein | - |
| QJB09_RS24960 (66613) | 66613..68226 | - | 1614 | WP_000080195.1 | IS66-like element ISEc23 family transposase | - |
| QJB09_RS24965 (68257) | 68257..68607 | - | 351 | WP_000624722.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| QJB09_RS24970 (68604) | 68604..69029 | - | 426 | WP_000422741.1 | transposase | - |
| QJB09_RS24975 (69588) | 69588..69800 | - | 213 | WP_013023861.1 | hypothetical protein | - |
| QJB09_RS24980 (69931) | 69931..70491 | - | 561 | WP_000139341.1 | fertility inhibition protein FinO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | dfrA17 / aadA5 / qacE / sul1 / mph(A) / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / blaCTX-M-27 | senB | 1..125500 | 125500 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 45 a.a. Molecular weight: 4896.90 Da Isoelectric Point: 7.7209
>T280804 WP_023144756.1 NZ_CP124518:c66177-66043 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
Download Length: 135 bp
Antitoxin
Download Length: 61 bp
>AT280804 NZ_CP124518:66222-66282 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
