Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
| Location | 4610452..4611131 | Replicon | chromosome |
| Accession | NZ_CP124517 | ||
| Organism | Escherichia coli strain AVS0343 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1PK60 |
| Locus tag | QJB09_RS22475 | Protein ID | WP_000057523.1 |
| Coordinates | 4610452..4610754 (+) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | S1QAY3 |
| Locus tag | QJB09_RS22480 | Protein ID | WP_000806442.1 |
| Coordinates | 4610790..4611131 (+) | Length | 114 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJB09_RS22450 (4605828) | 4605828..4607480 | + | 1653 | WP_000771748.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
| QJB09_RS22455 (4607518) | 4607518..4608021 | - | 504 | WP_000667000.1 | hypothetical protein | - |
| QJB09_RS22460 (4608018) | 4608018..4608818 | - | 801 | WP_000439798.1 | hypothetical protein | - |
| QJB09_RS22465 (4608842) | 4608842..4609321 | - | 480 | WP_000186633.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
| QJB09_RS22470 (4609525) | 4609525..4610319 | - | 795 | WP_000365147.1 | TraB/GumN family protein | - |
| QJB09_RS22475 (4610452) | 4610452..4610754 | + | 303 | WP_000057523.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QJB09_RS22480 (4610790) | 4610790..4611131 | + | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
| QJB09_RS22485 (4611189) | 4611189..4613693 | - | 2505 | WP_000083947.1 | copper-exporting P-type ATPase CopA | - |
| QJB09_RS22490 (4613955) | 4613955..4614887 | + | 933 | WP_000883041.1 | glutaminase A | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11809.44 Da Isoelectric Point: 10.3980
>T280803 WP_000057523.1 NZ_CP124517:4610452-4610754 [Escherichia coli]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|