Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 3408882..3409484 | Replicon | chromosome |
| Accession | NZ_CP124517 | ||
| Organism | Escherichia coli strain AVS0343 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1P416 |
| Locus tag | QJB09_RS16825 | Protein ID | WP_000897302.1 |
| Coordinates | 3408882..3409193 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QJB09_RS16830 | Protein ID | WP_000356397.1 |
| Coordinates | 3409194..3409484 (+) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJB09_RS16800 (3404796) | 3404796..3405395 | + | 600 | WP_001296610.1 | glucose-1-phosphatase | - |
| QJB09_RS16805 (3405389) | 3405389..3406261 | + | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| QJB09_RS16810 (3406258) | 3406258..3406695 | + | 438 | WP_000560981.1 | D-aminoacyl-tRNA deacylase | - |
| QJB09_RS16815 (3406740) | 3406740..3407681 | + | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| QJB09_RS16820 (3407745) | 3407745..3408653 | - | 909 | WP_001385591.1 | alpha/beta hydrolase | - |
| QJB09_RS16825 (3408882) | 3408882..3409193 | + | 312 | WP_000897302.1 | hypothetical protein | Toxin |
| QJB09_RS16830 (3409194) | 3409194..3409484 | + | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| QJB09_RS16835 (3409843) | 3409843..3410121 | + | 279 | WP_001296612.1 | hypothetical protein | - |
| QJB09_RS16840 (3410518) | 3410518..3410736 | + | 219 | WP_001251293.1 | CopG family transcriptional regulator | - |
| QJB09_RS16845 (3410921) | 3410921..3411661 | - | 741 | WP_000608806.1 | hypothetical protein | - |
| QJB09_RS16850 (3411686) | 3411686..3412534 | - | 849 | WP_001038650.1 | hypothetical protein | - |
| QJB09_RS16855 (3412824) | 3412824..3413066 | + | 243 | WP_001068514.1 | CopG family transcriptional regulator | - |
| QJB09_RS16860 (3413248) | 3413248..3414177 | - | 930 | WP_000027696.1 | formate dehydrogenase accessory protein FdhE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T280795 WP_000897302.1 NZ_CP124517:3408882-3409193 [Escherichia coli]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|