Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 3612288..3613015 | Replicon | chromosome |
Accession | NZ_CP124511 | ||
Organism | Escherichia coli strain AVS0501 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9ZMR4 |
Locus tag | QJP59_RS17825 | Protein ID | WP_000550189.1 |
Coordinates | 3612288..3612602 (+) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QJP59_RS17830 | Protein ID | WP_000560269.1 |
Coordinates | 3612599..3613015 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJP59_RS17805 (3608445) | 3608445..3609431 | - | 987 | WP_001385498.1 | Gfo/Idh/MocA family oxidoreductase | - |
QJP59_RS17810 (3609510) | 3609510..3610202 | - | 693 | WP_000942551.1 | vancomycin high temperature exclusion protein | - |
QJP59_RS17815 (3610279) | 3610279..3610782 | - | 504 | WP_001295542.1 | M48 family metallopeptidase | - |
QJP59_RS17820 (3610867) | 3610867..3612003 | + | 1137 | WP_000018703.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
QJP59_RS17825 (3612288) | 3612288..3612602 | + | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
QJP59_RS17830 (3612599) | 3612599..3613015 | + | 417 | WP_000560269.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
QJP59_RS17835 (3613060) | 3613060..3615078 | - | 2019 | WP_000121413.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
QJP59_RS17840 (3615304) | 3615304..3617655 | - | 2352 | WP_282517599.1 | alpha-glucosidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T280730 WP_000550189.1 NZ_CP124511:3612288-3612602 [Escherichia coli]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15023.47 Da Isoelectric Point: 4.4547
>AT280730 WP_000560269.1 NZ_CP124511:3612599-3613015 [Escherichia coli]
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFVEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFVEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|