Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
| Location | 3517088..3517767 | Replicon | chromosome |
| Accession | NZ_CP124508 | ||
| Organism | Escherichia coli strain AVS0068 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1PK60 |
| Locus tag | QJB02_RS17210 | Protein ID | WP_000057523.1 |
| Coordinates | 3517465..3517767 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | S1QAY3 |
| Locus tag | QJB02_RS17205 | Protein ID | WP_000806442.1 |
| Coordinates | 3517088..3517429 (-) | Length | 114 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJB02_RS17195 (3513332) | 3513332..3514264 | - | 933 | WP_000883041.1 | glutaminase A | - |
| QJB02_RS17200 (3514526) | 3514526..3517030 | + | 2505 | WP_000083947.1 | copper-exporting P-type ATPase CopA | - |
| QJB02_RS17205 (3517088) | 3517088..3517429 | - | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
| QJB02_RS17210 (3517465) | 3517465..3517767 | - | 303 | WP_000057523.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QJB02_RS17215 (3517900) | 3517900..3518694 | + | 795 | WP_000365147.1 | TraB/GumN family protein | - |
| QJB02_RS17220 (3518898) | 3518898..3519377 | + | 480 | WP_000186633.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
| QJB02_RS17225 (3519401) | 3519401..3520201 | + | 801 | WP_000439798.1 | hypothetical protein | - |
| QJB02_RS17230 (3520198) | 3520198..3520701 | + | 504 | WP_000667000.1 | hypothetical protein | - |
| QJB02_RS17235 (3520739) | 3520739..3522391 | - | 1653 | WP_000771748.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11809.44 Da Isoelectric Point: 10.3980
>T280705 WP_000057523.1 NZ_CP124508:c3517767-3517465 [Escherichia coli]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|