Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 4472794..4473593 | Replicon | chromosome |
| Accession | NZ_CP124502 | ||
| Organism | Escherichia coli strain AVS0970 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | S1NYM6 |
| Locus tag | QJP73_RS21600 | Protein ID | WP_000347251.1 |
| Coordinates | 4473129..4473593 (+) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1PPV5 |
| Locus tag | QJP73_RS21595 | Protein ID | WP_001296435.1 |
| Coordinates | 4472794..4473129 (+) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP73_RS21580 (4468579) | 4468579..4469349 | - | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
| QJP73_RS21585 (4469365) | 4469365..4470699 | - | 1335 | WP_000599651.1 | galactarate/glucarate/glycerate transporter GarP | - |
| QJP73_RS21590 (4471074) | 4471074..4472645 | + | 1572 | WP_001273763.1 | galactarate dehydratase | - |
| QJP73_RS21595 (4472794) | 4472794..4473129 | + | 336 | WP_001296435.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| QJP73_RS21600 (4473129) | 4473129..4473593 | + | 465 | WP_000347251.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| QJP73_RS21605 (4473648) | 4473648..4474457 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
| QJP73_RS21610 (4474706) | 4474706..4475986 | + | 1281 | WP_000681950.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| QJP73_RS21615 (4476009) | 4476009..4476482 | + | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| QJP73_RS21620 (4476493) | 4476493..4477272 | + | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| QJP73_RS21625 (4477262) | 4477262..4478140 | + | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| QJP73_RS21630 (4478158) | 4478158..4478592 | + | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17777.14 Da Isoelectric Point: 9.4947
>T280666 WP_000347251.1 NZ_CP124502:4473129-4473593 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CJ20 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1PPV5 |