Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-timR/Ldr(toxin)
Location 2287848..2288069 Replicon chromosome
Accession NZ_CP124502
Organism Escherichia coli strain AVS0970

Toxin (Protein)


Gene name ldrD Uniprot ID A0A1U9U3P9
Locus tag QJP73_RS11120 Protein ID WP_001531632.1
Coordinates 2287848..2287955 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name timR
Locus tag -
Coordinates 2288003..2288069 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP73_RS11095 (2283692) 2283692..2284774 + 1083 WP_000804726.1 peptide chain release factor 1 -
QJP73_RS11100 (2284774) 2284774..2285607 + 834 WP_000456450.1 peptide chain release factor N(5)-glutamine methyltransferase -
QJP73_RS11105 (2285604) 2285604..2285996 + 393 WP_000200375.1 invasion regulator SirB2 -
QJP73_RS11110 (2286000) 2286000..2286809 + 810 WP_001257044.1 invasion regulator SirB1 -
QJP73_RS11115 (2286845) 2286845..2287699 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
QJP73_RS11120 (2287848) 2287848..2287955 - 108 WP_001531632.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (2288005) 2288005..2288068 + 64 NuclAT_14 - -
- (2288005) 2288005..2288068 + 64 NuclAT_14 - -
- (2288005) 2288005..2288068 + 64 NuclAT_14 - -
- (2288005) 2288005..2288068 + 64 NuclAT_14 - -
- (2288005) 2288005..2288068 + 64 NuclAT_15 - -
- (2288005) 2288005..2288068 + 64 NuclAT_15 - -
- (2288005) 2288005..2288068 + 64 NuclAT_15 - -
- (2288005) 2288005..2288068 + 64 NuclAT_15 - -
- (2288005) 2288005..2288068 + 64 NuclAT_16 - -
- (2288005) 2288005..2288068 + 64 NuclAT_16 - -
- (2288005) 2288005..2288068 + 64 NuclAT_16 - -
- (2288005) 2288005..2288068 + 64 NuclAT_16 - -
- (2288005) 2288005..2288068 + 64 NuclAT_17 - -
- (2288005) 2288005..2288068 + 64 NuclAT_17 - -
- (2288005) 2288005..2288068 + 64 NuclAT_17 - -
- (2288005) 2288005..2288068 + 64 NuclAT_17 - -
- (2288005) 2288005..2288068 + 64 NuclAT_18 - -
- (2288005) 2288005..2288068 + 64 NuclAT_18 - -
- (2288005) 2288005..2288068 + 64 NuclAT_18 - -
- (2288005) 2288005..2288068 + 64 NuclAT_18 - -
- (2288005) 2288005..2288068 + 64 NuclAT_19 - -
- (2288005) 2288005..2288068 + 64 NuclAT_19 - -
- (2288005) 2288005..2288068 + 64 NuclAT_19 - -
- (2288005) 2288005..2288068 + 64 NuclAT_19 - -
- (2288003) 2288003..2288069 + 67 NuclAT_10 - Antitoxin
- (2288003) 2288003..2288069 + 67 NuclAT_10 - Antitoxin
- (2288003) 2288003..2288069 + 67 NuclAT_10 - Antitoxin
- (2288003) 2288003..2288069 + 67 NuclAT_10 - Antitoxin
- (2288003) 2288003..2288069 + 67 NuclAT_11 - Antitoxin
- (2288003) 2288003..2288069 + 67 NuclAT_11 - Antitoxin
- (2288003) 2288003..2288069 + 67 NuclAT_11 - Antitoxin
- (2288003) 2288003..2288069 + 67 NuclAT_11 - Antitoxin
- (2288003) 2288003..2288069 + 67 NuclAT_12 - Antitoxin
- (2288003) 2288003..2288069 + 67 NuclAT_12 - Antitoxin
- (2288003) 2288003..2288069 + 67 NuclAT_12 - Antitoxin
- (2288003) 2288003..2288069 + 67 NuclAT_12 - Antitoxin
- (2288003) 2288003..2288069 + 67 NuclAT_7 - Antitoxin
- (2288003) 2288003..2288069 + 67 NuclAT_7 - Antitoxin
- (2288003) 2288003..2288069 + 67 NuclAT_7 - Antitoxin
- (2288003) 2288003..2288069 + 67 NuclAT_7 - Antitoxin
- (2288003) 2288003..2288069 + 67 NuclAT_8 - Antitoxin
- (2288003) 2288003..2288069 + 67 NuclAT_8 - Antitoxin
- (2288003) 2288003..2288069 + 67 NuclAT_8 - Antitoxin
- (2288003) 2288003..2288069 + 67 NuclAT_8 - Antitoxin
- (2288003) 2288003..2288069 + 67 NuclAT_9 - Antitoxin
- (2288003) 2288003..2288069 + 67 NuclAT_9 - Antitoxin
- (2288003) 2288003..2288069 + 67 NuclAT_9 - Antitoxin
- (2288003) 2288003..2288069 + 67 NuclAT_9 - Antitoxin
- (2288005) 2288005..2288070 + 66 NuclAT_20 - -
- (2288005) 2288005..2288070 + 66 NuclAT_20 - -
- (2288005) 2288005..2288070 + 66 NuclAT_20 - -
- (2288005) 2288005..2288070 + 66 NuclAT_20 - -
- (2288005) 2288005..2288070 + 66 NuclAT_21 - -
- (2288005) 2288005..2288070 + 66 NuclAT_21 - -
- (2288005) 2288005..2288070 + 66 NuclAT_21 - -
- (2288005) 2288005..2288070 + 66 NuclAT_21 - -
- (2288005) 2288005..2288070 + 66 NuclAT_22 - -
- (2288005) 2288005..2288070 + 66 NuclAT_22 - -
- (2288005) 2288005..2288070 + 66 NuclAT_22 - -
- (2288005) 2288005..2288070 + 66 NuclAT_22 - -
- (2288005) 2288005..2288070 + 66 NuclAT_23 - -
- (2288005) 2288005..2288070 + 66 NuclAT_23 - -
- (2288005) 2288005..2288070 + 66 NuclAT_23 - -
- (2288005) 2288005..2288070 + 66 NuclAT_23 - -
- (2288005) 2288005..2288070 + 66 NuclAT_24 - -
- (2288005) 2288005..2288070 + 66 NuclAT_24 - -
- (2288005) 2288005..2288070 + 66 NuclAT_24 - -
- (2288005) 2288005..2288070 + 66 NuclAT_24 - -
- (2288005) 2288005..2288070 + 66 NuclAT_25 - -
- (2288005) 2288005..2288070 + 66 NuclAT_25 - -
- (2288005) 2288005..2288070 + 66 NuclAT_25 - -
- (2288005) 2288005..2288070 + 66 NuclAT_25 - -
QJP73_RS11125 (2288360) 2288360..2289460 - 1101 WP_000063608.1 sodium-potassium/proton antiporter ChaA -
QJP73_RS11130 (2289730) 2289730..2289969 + 240 WP_000120702.1 putative cation transport regulator ChaB -
QJP73_RS11135 (2290118) 2290118..2290813 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
QJP73_RS11140 (2290857) 2290857..2291210 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
QJP73_RS11145 (2291395) 2291395..2292789 + 1395 WP_000086187.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4040.89 Da        Isoelectric Point: 12.5163

>T280652 WP_001531632.1 NZ_CP124502:c2287955-2287848 [Escherichia coli]
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK

Download         Length: 108 bp

Antitoxin


Download         Length: 67 bp

>AT280652 NZ_CP124502:2288003-2288069 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1U9U3P9

Antitoxin

Download structure file

References