Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
| Location | 1485614..1486293 | Replicon | chromosome |
| Accession | NZ_CP124502 | ||
| Organism | Escherichia coli strain AVS0970 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1PK60 |
| Locus tag | QJP73_RS06975 | Protein ID | WP_000057523.1 |
| Coordinates | 1485614..1485916 (+) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | S1QAY3 |
| Locus tag | QJP73_RS06980 | Protein ID | WP_000806442.1 |
| Coordinates | 1485952..1486293 (+) | Length | 114 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP73_RS06950 (1480990) | 1480990..1482642 | + | 1653 | WP_000771748.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
| QJP73_RS06955 (1482680) | 1482680..1483183 | - | 504 | WP_000667000.1 | hypothetical protein | - |
| QJP73_RS06960 (1483180) | 1483180..1483980 | - | 801 | WP_000439798.1 | hypothetical protein | - |
| QJP73_RS06965 (1484004) | 1484004..1484483 | - | 480 | WP_000186633.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
| QJP73_RS06970 (1484687) | 1484687..1485481 | - | 795 | WP_000365147.1 | TraB/GumN family protein | - |
| QJP73_RS06975 (1485614) | 1485614..1485916 | + | 303 | WP_000057523.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QJP73_RS06980 (1485952) | 1485952..1486293 | + | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
| QJP73_RS06985 (1486351) | 1486351..1488855 | - | 2505 | WP_000083947.1 | copper-exporting P-type ATPase CopA | - |
| QJP73_RS06990 (1489117) | 1489117..1490049 | + | 933 | WP_000883041.1 | glutaminase A | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11809.44 Da Isoelectric Point: 10.3980
>T280650 WP_000057523.1 NZ_CP124502:1485614-1485916 [Escherichia coli]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|