Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
| Location | 3589902..3590581 | Replicon | chromosome |
| Accession | NZ_CP124498 | ||
| Organism | Escherichia coli strain AVS0655 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1PK60 |
| Locus tag | QJP65_RS17665 | Protein ID | WP_000057523.1 |
| Coordinates | 3590279..3590581 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | S1QAY3 |
| Locus tag | QJP65_RS17660 | Protein ID | WP_000806442.1 |
| Coordinates | 3589902..3590243 (-) | Length | 114 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP65_RS17650 (3586146) | 3586146..3587078 | - | 933 | WP_000883041.1 | glutaminase A | - |
| QJP65_RS17655 (3587340) | 3587340..3589844 | + | 2505 | WP_000083947.1 | copper-exporting P-type ATPase CopA | - |
| QJP65_RS17660 (3589902) | 3589902..3590243 | - | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
| QJP65_RS17665 (3590279) | 3590279..3590581 | - | 303 | WP_000057523.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QJP65_RS17670 (3590714) | 3590714..3591508 | + | 795 | WP_000365147.1 | TraB/GumN family protein | - |
| QJP65_RS17675 (3591712) | 3591712..3592191 | + | 480 | WP_000186633.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
| QJP65_RS17680 (3592215) | 3592215..3593015 | + | 801 | WP_000439798.1 | hypothetical protein | - |
| QJP65_RS17685 (3593012) | 3593012..3593515 | + | 504 | WP_000667000.1 | hypothetical protein | - |
| QJP65_RS17690 (3593553) | 3593553..3595205 | - | 1653 | WP_000771748.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11809.44 Da Isoelectric Point: 10.3980
>T280615 WP_000057523.1 NZ_CP124498:c3590581-3590279 [Escherichia coli]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|