Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 53898..54227 | Replicon | plasmid pAVS0662-A |
| Accession | NZ_CP124496 | ||
| Organism | Escherichia coli strain AVS0662 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | QJP57_RS24330 | Protein ID | WP_001372321.1 |
| Coordinates | 53898..54023 (-) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 54100..54227 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP57_RS24290 (49014) | 49014..49241 | - | 228 | WP_001254388.1 | conjugal transfer relaxosome protein TraY | - |
| QJP57_RS24295 (49329) | 49329..50006 | - | 678 | WP_001348626.1 | PAS domain-containing protein | - |
| QJP57_RS24300 (50140) | 50140..50523 | - | 384 | WP_001151566.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| QJP57_RS24305 (50865) | 50865..51455 | + | 591 | WP_001376243.1 | transglycosylase SLT domain-containing protein | - |
| QJP57_RS24310 (51752) | 51752..52573 | - | 822 | WP_001234469.1 | DUF932 domain-containing protein | - |
| QJP57_RS24315 (52692) | 52692..52979 | - | 288 | WP_000107535.1 | hypothetical protein | - |
| QJP57_RS24320 (53277) | 53277..53451 | + | 175 | Protein_63 | hypothetical protein | - |
| QJP57_RS24325 (53449) | 53449..53679 | - | 231 | WP_001426396.1 | hypothetical protein | - |
| QJP57_RS24330 (53898) | 53898..54023 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| QJP57_RS24335 (53965) | 53965..54114 | - | 150 | Protein_66 | plasmid maintenance protein Mok | - |
| - (54100) | 54100..54227 | - | 128 | NuclAT_0 | - | Antitoxin |
| - (54100) | 54100..54227 | - | 128 | NuclAT_0 | - | Antitoxin |
| - (54100) | 54100..54227 | - | 128 | NuclAT_0 | - | Antitoxin |
| - (54100) | 54100..54227 | - | 128 | NuclAT_0 | - | Antitoxin |
| QJP57_RS24340 (54254) | 54254..55623 | - | 1370 | Protein_67 | IS3-like element IS150 family transposase | - |
| - (55669) | 55669..55771 | - | 103 | NuclAT_1 | - | - |
| - (55669) | 55669..55771 | - | 103 | NuclAT_1 | - | - |
| - (55669) | 55669..55771 | - | 103 | NuclAT_1 | - | - |
| - (55669) | 55669..55771 | - | 103 | NuclAT_1 | - | - |
| QJP57_RS24345 (55740) | 55740..56501 | - | 762 | Protein_68 | plasmid SOS inhibition protein A | - |
| QJP57_RS24350 (56498) | 56498..56932 | - | 435 | WP_000845949.1 | conjugation system SOS inhibitor PsiB | - |
| QJP57_RS24355 (56986) | 56986..58942 | - | 1957 | Protein_70 | ParB/RepB/Spo0J family partition protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | senB | 1..88152 | 88152 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T280596 WP_001372321.1 NZ_CP124496:c54023-53898 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 128 bp
>AT280596 NZ_CP124496:c54227-54100 [Escherichia coli]
CGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGAAGATAGCCCCGTAGTAA
GTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
CGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGAAGATAGCCCCGTAGTAA
GTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
