Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 3949063..3949321 | Replicon | chromosome |
Accession | NZ_CP124490 | ||
Organism | Escherichia coli strain AVS0456 |
Toxin (Protein)
Gene name | hokC | Uniprot ID | - |
Locus tag | QJP91_RS19105 | Protein ID | WP_000634316.1 |
Coordinates | 3949187..3949321 (+) | Length | 45 a.a. |
Antitoxin (RNA)
Gene name | sokC | ||
Locus tag | - | ||
Coordinates | 3949063..3949120 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJP91_RS19090 | 3944892..3946151 | - | 1260 | WP_000494928.1 | hypothetical protein | - |
QJP91_RS19095 | 3946280..3947773 | - | 1494 | WP_001173016.1 | sulfatase-like hydrolase/transferase | - |
QJP91_RS19100 | 3947794..3948555 | - | 762 | WP_001274833.1 | outer membrane protein OmpK | - |
- | 3949063..3949120 | - | 58 | - | - | Antitoxin |
QJP91_RS19105 | 3949187..3949321 | + | 135 | WP_000634316.1 | Hok/Gef family protein | Toxin |
QJP91_RS19110 | 3949425..3950555 | - | 1131 | WP_001118464.1 | molecular chaperone DnaJ | - |
QJP91_RS19115 | 3950644..3952560 | - | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
QJP91_RS19120 | 3952931..3953335 | + | 405 | WP_000843689.1 | DUF2541 family protein | - |
QJP91_RS19125 | 3953361..3954074 | + | 714 | WP_001102393.1 | acidic protein MsyB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 45 a.a. Molecular weight: 4777.67 Da Isoelectric Point: 4.6979
>T280552 WP_000634316.1 NZ_CP124490:3949187-3949321 [Escherichia coli]
MIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 135 bp
Antitoxin
Download Length: 58 bp
>AT280552 NZ_CP124490:c3949120-3949063 [Escherichia coli]
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|