Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
Location | 3466163..3466842 | Replicon | chromosome |
Accession | NZ_CP124490 | ||
Organism | Escherichia coli strain AVS0456 |
Toxin (Protein)
Gene name | higB | Uniprot ID | S1PK60 |
Locus tag | QJP91_RS16870 | Protein ID | WP_000057523.1 |
Coordinates | 3466540..3466842 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | S1QAY3 |
Locus tag | QJP91_RS16865 | Protein ID | WP_000806442.1 |
Coordinates | 3466163..3466504 (-) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJP91_RS16855 (3462407) | 3462407..3463339 | - | 933 | WP_000883041.1 | glutaminase A | - |
QJP91_RS16860 (3463601) | 3463601..3466105 | + | 2505 | WP_000083947.1 | copper-exporting P-type ATPase CopA | - |
QJP91_RS16865 (3466163) | 3466163..3466504 | - | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
QJP91_RS16870 (3466540) | 3466540..3466842 | - | 303 | WP_000057523.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QJP91_RS16875 (3466975) | 3466975..3467769 | + | 795 | WP_000365147.1 | TraB/GumN family protein | - |
QJP91_RS16880 (3467973) | 3467973..3468452 | + | 480 | WP_000186633.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
QJP91_RS16885 (3468476) | 3468476..3469276 | + | 801 | WP_000439798.1 | hypothetical protein | - |
QJP91_RS16890 (3469273) | 3469273..3469776 | + | 504 | WP_000667000.1 | hypothetical protein | - |
QJP91_RS16895 (3469814) | 3469814..3471466 | - | 1653 | WP_000771748.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11809.44 Da Isoelectric Point: 10.3980
>T280548 WP_000057523.1 NZ_CP124490:c3466842-3466540 [Escherichia coli]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|