Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 13794..14033 | Replicon | plasmid pAVS0542-A |
| Accession | NZ_CP124488 | ||
| Organism | Escherichia coli strain AVS0542 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | A0A762TWR7 |
| Locus tag | QJP68_RS24340 | Protein ID | WP_023144756.1 |
| Coordinates | 13794..13928 (-) | Length | 45 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 13973..14033 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP68_RS24305 (9141) | 9141..9556 | - | 416 | Protein_11 | IS1-like element IS1B family transposase | - |
| QJP68_RS24310 (9805) | 9805..10206 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| QJP68_RS24315 (10139) | 10139..10396 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| QJP68_RS24320 (10489) | 10489..11142 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| QJP68_RS24325 (12082) | 12082..12939 | - | 858 | WP_001617855.1 | incFII family plasmid replication initiator RepA | - |
| QJP68_RS24330 (12932) | 12932..13006 | - | 75 | WP_031943482.1 | RepA leader peptide Tap | - |
| QJP68_RS24335 (13243) | 13243..13497 | - | 255 | WP_000083850.1 | replication regulatory protein RepA | - |
| QJP68_RS24340 (13794) | 13794..13928 | - | 135 | WP_023144756.1 | Hok/Gef family protein | Toxin |
| - (13973) | 13973..14033 | + | 61 | NuclAT_0 | - | Antitoxin |
| - (13973) | 13973..14033 | + | 61 | NuclAT_0 | - | Antitoxin |
| - (13973) | 13973..14033 | + | 61 | NuclAT_0 | - | Antitoxin |
| - (13973) | 13973..14033 | + | 61 | NuclAT_0 | - | Antitoxin |
| QJP68_RS24345 (14000) | 14000..14286 | - | 287 | Protein_19 | DUF2726 domain-containing protein | - |
| QJP68_RS24350 (14364) | 14364..15977 | - | 1614 | WP_000080195.1 | IS66-like element ISEc23 family transposase | - |
| QJP68_RS24355 (16008) | 16008..16358 | - | 351 | WP_000624722.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| QJP68_RS24360 (16355) | 16355..16780 | - | 426 | WP_000422741.1 | transposase | - |
| QJP68_RS24365 (17339) | 17339..17551 | - | 213 | WP_013023861.1 | hypothetical protein | - |
| QJP68_RS24370 (17682) | 17682..18242 | - | 561 | WP_000139341.1 | fertility inhibition protein FinO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | blaCTX-M-27 | - | 1..69343 | 69343 | |
| - | inside | IScluster/Tn | blaCTX-M-27 | - | 5440..16780 | 11340 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 45 a.a. Molecular weight: 4896.90 Da Isoelectric Point: 7.7209
>T280530 WP_023144756.1 NZ_CP124488:c13928-13794 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
Download Length: 135 bp
Antitoxin
Download Length: 61 bp
>AT280530 NZ_CP124488:13973-14033 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
