Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
Location | 3629648..3630327 | Replicon | chromosome |
Accession | NZ_CP124487 | ||
Organism | Escherichia coli strain AVS0542 |
Toxin (Protein)
Gene name | higB | Uniprot ID | S1PK60 |
Locus tag | QJP68_RS17910 | Protein ID | WP_000057523.1 |
Coordinates | 3630025..3630327 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | S1QAY3 |
Locus tag | QJP68_RS17905 | Protein ID | WP_000806442.1 |
Coordinates | 3629648..3629989 (-) | Length | 114 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJP68_RS17895 (3625892) | 3625892..3626824 | - | 933 | WP_000883041.1 | glutaminase A | - |
QJP68_RS17900 (3627086) | 3627086..3629590 | + | 2505 | WP_000083947.1 | copper-exporting P-type ATPase CopA | - |
QJP68_RS17905 (3629648) | 3629648..3629989 | - | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
QJP68_RS17910 (3630025) | 3630025..3630327 | - | 303 | WP_000057523.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QJP68_RS17915 (3630460) | 3630460..3631254 | + | 795 | WP_000365147.1 | TraB/GumN family protein | - |
QJP68_RS17920 (3631458) | 3631458..3631937 | + | 480 | WP_000186633.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
QJP68_RS17925 (3631961) | 3631961..3632761 | + | 801 | WP_000439798.1 | hypothetical protein | - |
QJP68_RS17930 (3632758) | 3632758..3633261 | + | 504 | WP_000667000.1 | hypothetical protein | - |
QJP68_RS17935 (3633299) | 3633299..3634951 | - | 1653 | WP_000771748.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11809.44 Da Isoelectric Point: 10.3980
>T280524 WP_000057523.1 NZ_CP124487:c3630327-3630025 [Escherichia coli]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|