Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | HipBST/HipA(toxin) |
Location | 242324..243642 | Replicon | chromosome |
Accession | NZ_CP124483 | ||
Organism | Escherichia coli strain AVS0575 |
Toxin (Protein)
Gene name | HipT | Uniprot ID | F4T5A3 |
Locus tag | QJP96_RS01145 | Protein ID | WP_001262467.1 |
Coordinates | 242635..243642 (+) | Length | 336 a.a. |
Antitoxin (Protein)
Gene name | HipS | Uniprot ID | F4T5A4 |
Locus tag | QJP96_RS01140 | Protein ID | WP_001312177.1 |
Coordinates | 242324..242635 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJP96_RS01115 (237856) | 237856..238875 | + | 1020 | WP_000938855.1 | dipeptide ABC transporter permease DppB | - |
QJP96_RS01120 (238885) | 238885..239787 | + | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
QJP96_RS01125 (239798) | 239798..240781 | + | 984 | WP_001196477.1 | dipeptide ABC transporter ATP-binding protein | - |
QJP96_RS01130 (240778) | 240778..241791 | + | 1014 | WP_000103572.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
QJP96_RS01135 (242016) | 242016..242339 | + | 324 | WP_000563102.1 | helix-turn-helix transcriptional regulator | - |
QJP96_RS01140 (242324) | 242324..242635 | + | 312 | WP_001312177.1 | HipA N-terminal domain-containing protein | Antitoxin |
QJP96_RS01145 (242635) | 242635..243642 | + | 1008 | WP_001262467.1 | HipA domain-containing protein | Toxin |
QJP96_RS01150 (243659) | 243659..244930 | - | 1272 | WP_001545666.1 | amino acid permease | - |
- (245292) | 245292..245357 | - | 66 | NuclAT_27 | - | - |
- (245292) | 245292..245357 | - | 66 | NuclAT_27 | - | - |
- (245292) | 245292..245357 | - | 66 | NuclAT_27 | - | - |
- (245292) | 245292..245357 | - | 66 | NuclAT_27 | - | - |
QJP96_RS01155 (245406) | 245406..245513 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- (245775) | 245775..245832 | - | 58 | NuclAT_26 | - | - |
- (245775) | 245775..245832 | - | 58 | NuclAT_26 | - | - |
- (245775) | 245775..245832 | - | 58 | NuclAT_26 | - | - |
- (245775) | 245775..245832 | - | 58 | NuclAT_26 | - | - |
QJP96_RS01160 (245889) | 245889..245996 | + | 108 | WP_000170748.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
QJP96_RS01165 (246372) | 246372..246479 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
QJP96_RS01170 (246565) | 246565..248244 | - | 1680 | Protein_231 | cellulose biosynthesis protein BcsG | - |
QJP96_RS01175 (248241) | 248241..248432 | - | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 336 a.a. Molecular weight: 38320.60 Da Isoelectric Point: 5.5965
>T280489 WP_001262467.1 NZ_CP124483:242635-243642 [Escherichia coli]
MANCRILLTPLNERDEQRGYSTQGLKRLSGTAKLTPRLGFTRTQFVQELPRQQKGMSISGYQPKLQLVLDEGEFRVVDHQ
GNFILKPSPADFPGLAENEHATMTLMSRLGFDVPVHGLLSFAPQSEEELEYAFVIRRYDRDNKGLPVHQEQLDGAMQIMD
KYGKTGNDNEQYVSYETLARFLVAHVNDNIAFKIDLFRRIVYAWLLGNNDMHLRNFGLVYSDGLTPALAPVYDFVSVAPY
PEYFHSNYLALPLLTREEGGRELAPGFHSDYGEYIGQDFLLLGESMGLAPRLLEKLFQDIRKENAIVMETYEQSFMTQDH
IQAVLQCYRHRLGLL
MANCRILLTPLNERDEQRGYSTQGLKRLSGTAKLTPRLGFTRTQFVQELPRQQKGMSISGYQPKLQLVLDEGEFRVVDHQ
GNFILKPSPADFPGLAENEHATMTLMSRLGFDVPVHGLLSFAPQSEEELEYAFVIRRYDRDNKGLPVHQEQLDGAMQIMD
KYGKTGNDNEQYVSYETLARFLVAHVNDNIAFKIDLFRRIVYAWLLGNNDMHLRNFGLVYSDGLTPALAPVYDFVSVAPY
PEYFHSNYLALPLLTREEGGRELAPGFHSDYGEYIGQDFLLLGESMGLAPRLLEKLFQDIRKENAIVMETYEQSFMTQDH
IQAVLQCYRHRLGLL
Download Length: 1008 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3K2ZTB5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3L3HKE2 |