Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 53076..53315 | Replicon | plasmid pAVS0756-A |
| Accession | NZ_CP124482 | ||
| Organism | Escherichia coli strain AVS0756 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | A0A762TWR7 |
| Locus tag | QJP55_RS23870 | Protein ID | WP_023144756.1 |
| Coordinates | 53076..53210 (-) | Length | 45 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 53255..53315 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP55_RS23835 (48423) | 48423..48838 | - | 416 | Protein_61 | IS1-like element IS1B family transposase | - |
| QJP55_RS23840 (49087) | 49087..49488 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| QJP55_RS23845 (49421) | 49421..49678 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| QJP55_RS23850 (49771) | 49771..50424 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| QJP55_RS23855 (51364) | 51364..52221 | - | 858 | WP_001617855.1 | incFII family plasmid replication initiator RepA | - |
| QJP55_RS23860 (52214) | 52214..52288 | - | 75 | WP_031943482.1 | RepA leader peptide Tap | - |
| QJP55_RS23865 (52525) | 52525..52779 | - | 255 | WP_000083850.1 | replication regulatory protein RepA | - |
| QJP55_RS23870 (53076) | 53076..53210 | - | 135 | WP_023144756.1 | Hok/Gef family protein | Toxin |
| - (53255) | 53255..53315 | + | 61 | NuclAT_0 | - | Antitoxin |
| - (53255) | 53255..53315 | + | 61 | NuclAT_0 | - | Antitoxin |
| - (53255) | 53255..53315 | + | 61 | NuclAT_0 | - | Antitoxin |
| - (53255) | 53255..53315 | + | 61 | NuclAT_0 | - | Antitoxin |
| QJP55_RS23875 (53282) | 53282..53568 | - | 287 | Protein_69 | DUF2726 domain-containing protein | - |
| QJP55_RS23880 (53646) | 53646..55259 | - | 1614 | WP_000080195.1 | IS66-like element ISEc23 family transposase | - |
| QJP55_RS23885 (55290) | 55290..55640 | - | 351 | WP_000624722.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| QJP55_RS23890 (55637) | 55637..56062 | - | 426 | WP_000422741.1 | transposase | - |
| QJP55_RS23895 (56621) | 56621..56833 | - | 213 | WP_013023861.1 | hypothetical protein | - |
| QJP55_RS23900 (56964) | 56964..57524 | - | 561 | WP_000139341.1 | fertility inhibition protein FinO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / blaCTX-M-27 | - | 1..108535 | 108535 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 45 a.a. Molecular weight: 4896.90 Da Isoelectric Point: 7.7209
>T280482 WP_023144756.1 NZ_CP124482:c53210-53076 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
Download Length: 135 bp
Antitoxin
Download Length: 61 bp
>AT280482 NZ_CP124482:53255-53315 [Escherichia coli]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
