Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 4385578..4386377 | Replicon | chromosome |
| Accession | NZ_CP124481 | ||
| Organism | Escherichia coli strain AVS0756 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | S1NYM6 |
| Locus tag | QJP55_RS21320 | Protein ID | WP_000347251.1 |
| Coordinates | 4385913..4386377 (+) | Length | 155 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | S1PPV5 |
| Locus tag | QJP55_RS21315 | Protein ID | WP_001296435.1 |
| Coordinates | 4385578..4385913 (+) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP55_RS21300 (4381363) | 4381363..4382133 | - | 771 | WP_001058227.1 | 2-dehydro-3-deoxyglucarate aldolase | - |
| QJP55_RS21305 (4382149) | 4382149..4383483 | - | 1335 | WP_000599651.1 | galactarate/glucarate/glycerate transporter GarP | - |
| QJP55_RS21310 (4383858) | 4383858..4385429 | + | 1572 | WP_001273763.1 | galactarate dehydratase | - |
| QJP55_RS21315 (4385578) | 4385578..4385913 | + | 336 | WP_001296435.1 | type II toxin-antitoxin system antitoxin PrlF | Antitoxin |
| QJP55_RS21320 (4385913) | 4385913..4386377 | + | 465 | WP_000347251.1 | type II toxin-antitoxin system ribonuclease toxin YhaV | Toxin |
| QJP55_RS21325 (4386432) | 4386432..4387241 | - | 810 | WP_000072187.1 | aga operon transcriptional regulator AgaR | - |
| QJP55_RS21330 (4387490) | 4387490..4388770 | + | 1281 | WP_000681950.1 | tagatose-bisphosphate aldolase subunit KbaZ | - |
| QJP55_RS21335 (4388793) | 4388793..4389266 | + | 474 | WP_001295547.1 | PTS N-acetylgalactosamine transporter subunit IIB | - |
| QJP55_RS21340 (4389277) | 4389277..4390056 | + | 780 | WP_000406214.1 | PTS N-acetylgalactosamine transporter subunit IIC | - |
| QJP55_RS21345 (4390046) | 4390046..4390924 | + | 879 | WP_001295548.1 | PTS N-acetylgalactosamine transporter subunit IID | - |
| QJP55_RS21350 (4390942) | 4390942..4391376 | + | 435 | WP_000948824.1 | PTS galactosamine/N-acetylgalactosamine transporter subunit IIA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 155 a.a. Molecular weight: 17777.14 Da Isoelectric Point: 9.4947
>T280481 WP_000347251.1 NZ_CP124481:4385913-4386377 [Escherichia coli]
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
MDFPQRVNGWALYAHPCFQETYDALVAEVEALKGKDPENYQRKAATKLLAVVHKVIEEHITVNPSSPAFRHGKSLGSGKN
KDWSRVKFGAGRYRLFFRYSEKEKVIILGWMNDENTLRTYGKKTDAYTVFSKMLKRGHPPADWESLTQETEENH
Download Length: 465 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CJ20 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1PPV5 |