Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-timR/Ldr(toxin)
Location 2315249..2315470 Replicon chromosome
Accession NZ_CP124481
Organism Escherichia coli strain AVS0756

Toxin (Protein)


Gene name ldrD Uniprot ID A0A1U9U3P9
Locus tag QJP55_RS11375 Protein ID WP_001531632.1
Coordinates 2315249..2315356 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name timR
Locus tag -
Coordinates 2315404..2315470 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP55_RS11350 (2311093) 2311093..2312175 + 1083 WP_000804726.1 peptide chain release factor 1 -
QJP55_RS11355 (2312175) 2312175..2313008 + 834 WP_000456450.1 peptide chain release factor N(5)-glutamine methyltransferase -
QJP55_RS11360 (2313005) 2313005..2313397 + 393 WP_000200375.1 invasion regulator SirB2 -
QJP55_RS11365 (2313401) 2313401..2314210 + 810 WP_001257044.1 invasion regulator SirB1 -
QJP55_RS11370 (2314246) 2314246..2315100 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
QJP55_RS11375 (2315249) 2315249..2315356 - 108 WP_001531632.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (2315406) 2315406..2315469 + 64 NuclAT_14 - -
- (2315406) 2315406..2315469 + 64 NuclAT_14 - -
- (2315406) 2315406..2315469 + 64 NuclAT_14 - -
- (2315406) 2315406..2315469 + 64 NuclAT_14 - -
- (2315406) 2315406..2315469 + 64 NuclAT_15 - -
- (2315406) 2315406..2315469 + 64 NuclAT_15 - -
- (2315406) 2315406..2315469 + 64 NuclAT_15 - -
- (2315406) 2315406..2315469 + 64 NuclAT_15 - -
- (2315406) 2315406..2315469 + 64 NuclAT_16 - -
- (2315406) 2315406..2315469 + 64 NuclAT_16 - -
- (2315406) 2315406..2315469 + 64 NuclAT_16 - -
- (2315406) 2315406..2315469 + 64 NuclAT_16 - -
- (2315406) 2315406..2315469 + 64 NuclAT_17 - -
- (2315406) 2315406..2315469 + 64 NuclAT_17 - -
- (2315406) 2315406..2315469 + 64 NuclAT_17 - -
- (2315406) 2315406..2315469 + 64 NuclAT_17 - -
- (2315406) 2315406..2315469 + 64 NuclAT_18 - -
- (2315406) 2315406..2315469 + 64 NuclAT_18 - -
- (2315406) 2315406..2315469 + 64 NuclAT_18 - -
- (2315406) 2315406..2315469 + 64 NuclAT_18 - -
- (2315406) 2315406..2315469 + 64 NuclAT_19 - -
- (2315406) 2315406..2315469 + 64 NuclAT_19 - -
- (2315406) 2315406..2315469 + 64 NuclAT_19 - -
- (2315406) 2315406..2315469 + 64 NuclAT_19 - -
- (2315404) 2315404..2315470 + 67 NuclAT_10 - Antitoxin
- (2315404) 2315404..2315470 + 67 NuclAT_10 - Antitoxin
- (2315404) 2315404..2315470 + 67 NuclAT_10 - Antitoxin
- (2315404) 2315404..2315470 + 67 NuclAT_10 - Antitoxin
- (2315404) 2315404..2315470 + 67 NuclAT_11 - Antitoxin
- (2315404) 2315404..2315470 + 67 NuclAT_11 - Antitoxin
- (2315404) 2315404..2315470 + 67 NuclAT_11 - Antitoxin
- (2315404) 2315404..2315470 + 67 NuclAT_11 - Antitoxin
- (2315404) 2315404..2315470 + 67 NuclAT_12 - Antitoxin
- (2315404) 2315404..2315470 + 67 NuclAT_12 - Antitoxin
- (2315404) 2315404..2315470 + 67 NuclAT_12 - Antitoxin
- (2315404) 2315404..2315470 + 67 NuclAT_12 - Antitoxin
- (2315404) 2315404..2315470 + 67 NuclAT_7 - Antitoxin
- (2315404) 2315404..2315470 + 67 NuclAT_7 - Antitoxin
- (2315404) 2315404..2315470 + 67 NuclAT_7 - Antitoxin
- (2315404) 2315404..2315470 + 67 NuclAT_7 - Antitoxin
- (2315404) 2315404..2315470 + 67 NuclAT_8 - Antitoxin
- (2315404) 2315404..2315470 + 67 NuclAT_8 - Antitoxin
- (2315404) 2315404..2315470 + 67 NuclAT_8 - Antitoxin
- (2315404) 2315404..2315470 + 67 NuclAT_8 - Antitoxin
- (2315404) 2315404..2315470 + 67 NuclAT_9 - Antitoxin
- (2315404) 2315404..2315470 + 67 NuclAT_9 - Antitoxin
- (2315404) 2315404..2315470 + 67 NuclAT_9 - Antitoxin
- (2315404) 2315404..2315470 + 67 NuclAT_9 - Antitoxin
- (2315406) 2315406..2315471 + 66 NuclAT_20 - -
- (2315406) 2315406..2315471 + 66 NuclAT_20 - -
- (2315406) 2315406..2315471 + 66 NuclAT_20 - -
- (2315406) 2315406..2315471 + 66 NuclAT_20 - -
- (2315406) 2315406..2315471 + 66 NuclAT_21 - -
- (2315406) 2315406..2315471 + 66 NuclAT_21 - -
- (2315406) 2315406..2315471 + 66 NuclAT_21 - -
- (2315406) 2315406..2315471 + 66 NuclAT_21 - -
- (2315406) 2315406..2315471 + 66 NuclAT_22 - -
- (2315406) 2315406..2315471 + 66 NuclAT_22 - -
- (2315406) 2315406..2315471 + 66 NuclAT_22 - -
- (2315406) 2315406..2315471 + 66 NuclAT_22 - -
- (2315406) 2315406..2315471 + 66 NuclAT_23 - -
- (2315406) 2315406..2315471 + 66 NuclAT_23 - -
- (2315406) 2315406..2315471 + 66 NuclAT_23 - -
- (2315406) 2315406..2315471 + 66 NuclAT_23 - -
- (2315406) 2315406..2315471 + 66 NuclAT_24 - -
- (2315406) 2315406..2315471 + 66 NuclAT_24 - -
- (2315406) 2315406..2315471 + 66 NuclAT_24 - -
- (2315406) 2315406..2315471 + 66 NuclAT_24 - -
- (2315406) 2315406..2315471 + 66 NuclAT_25 - -
- (2315406) 2315406..2315471 + 66 NuclAT_25 - -
- (2315406) 2315406..2315471 + 66 NuclAT_25 - -
- (2315406) 2315406..2315471 + 66 NuclAT_25 - -
QJP55_RS11380 (2315761) 2315761..2316861 - 1101 WP_000063608.1 sodium-potassium/proton antiporter ChaA -
QJP55_RS11385 (2317131) 2317131..2317370 + 240 WP_000120702.1 putative cation transport regulator ChaB -
QJP55_RS11390 (2317519) 2317519..2318214 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
QJP55_RS11395 (2318258) 2318258..2318611 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
QJP55_RS11400 (2318796) 2318796..2320190 + 1395 WP_000086187.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4040.89 Da        Isoelectric Point: 12.5163

>T280466 WP_001531632.1 NZ_CP124481:c2315356-2315249 [Escherichia coli]
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK

Download         Length: 108 bp

Antitoxin


Download         Length: 67 bp

>AT280466 NZ_CP124481:2315404-2315470 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1U9U3P9

Antitoxin

Download structure file

References