Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 32034..32303 | Replicon | plasmid pAVS0969-C |
| Accession | NZ_CP124478 | ||
| Organism | Escherichia coli strain AVS0969 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | QJP78_RS26875 | Protein ID | WP_001372321.1 |
| Coordinates | 32178..32303 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 32034..32099 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP78_RS26835 (27057) | 27057..27501 | - | 445 | Protein_34 | hypothetical protein | - |
| QJP78_RS26840 (27803) | 27803..28330 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
| QJP78_RS26845 (28388) | 28388..28621 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
| QJP78_RS26850 (28682) | 28682..30646 | + | 1965 | WP_000117316.1 | ParB/RepB/Spo0J family partition protein | - |
| QJP78_RS26855 (30715) | 30715..31149 | + | 435 | WP_059514203.1 | conjugation system SOS inhibitor PsiB | - |
| QJP78_RS26860 (31146) | 31146..31908 | + | 763 | Protein_39 | plasmid SOS inhibition protein A | - |
| QJP78_RS26865 (31886) | 31886..32065 | - | 180 | WP_001309233.1 | hypothetical protein | - |
| - (32034) | 32034..32099 | + | 66 | NuclAT_1 | - | - |
| - (32034) | 32034..32099 | - | 66 | NuclAT_0 | - | Antitoxin |
| - (31877) | 31877..32101 | + | 225 | NuclAT_0 | - | - |
| - (31877) | 31877..32101 | + | 225 | NuclAT_0 | - | - |
| - (31877) | 31877..32101 | + | 225 | NuclAT_0 | - | - |
| - (31877) | 31877..32101 | + | 225 | NuclAT_0 | - | - |
| - (31880) | 31880..32101 | - | 222 | NuclAT_0 | - | - |
| QJP78_RS26870 (32087) | 32087..32236 | + | 150 | Protein_41 | plasmid maintenance protein Mok | - |
| QJP78_RS26875 (32178) | 32178..32303 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| QJP78_RS26880 (32622) | 32622..32919 | - | 298 | Protein_43 | hypothetical protein | - |
| QJP78_RS26885 (33219) | 33219..33515 | + | 297 | WP_001272251.1 | hypothetical protein | - |
| QJP78_RS26890 (33626) | 33626..34447 | + | 822 | WP_021549731.1 | DUF932 domain-containing protein | - |
| QJP78_RS26895 (34744) | 34744..35346 | - | 603 | WP_000243713.1 | transglycosylase SLT domain-containing protein | - |
| QJP78_RS26900 (35669) | 35669..36052 | + | 384 | WP_001354030.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| QJP78_RS26905 (36246) | 36246..36917 | + | 672 | WP_000283561.1 | conjugal transfer transcriptional regulator TraJ | - |
| QJP78_RS26910 (37054) | 37054..37281 | + | 228 | WP_000089263.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T280455 WP_001372321.1 NZ_CP124478:32178-32303 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 66 bp
>AT280455 NZ_CP124478:c32099-32034 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
