Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 40288..40552 Replicon plasmid pAVS0969-B
Accession NZ_CP124477
Organism Escherichia coli strain AVS0969

Toxin (Protein)


Gene name pndA Uniprot ID U9Y6M3
Locus tag QJP78_RS26420 Protein ID WP_001331364.1
Coordinates 40400..40552 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 40288..40350 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP78_RS26405 (35527) 35527..37818 - 2292 WP_021520372.1 F-type conjugative transfer protein TrbC -
QJP78_RS26410 (37811) 37811..38881 - 1071 WP_001542508.1 IncI1-type conjugal transfer protein TrbB -
QJP78_RS26415 (38900) 38900..40108 - 1209 WP_000121273.1 IncI1-type conjugal transfer protein TrbA -
- (40288) 40288..40350 - 63 NuclAT_0 - Antitoxin
- (40288) 40288..40350 - 63 NuclAT_0 - Antitoxin
- (40288) 40288..40350 - 63 NuclAT_0 - Antitoxin
- (40288) 40288..40350 - 63 NuclAT_0 - Antitoxin
QJP78_RS26420 (40400) 40400..40552 + 153 WP_001331364.1 Hok/Gef family protein Toxin
QJP78_RS26425 (40624) 40624..40875 - 252 WP_001291964.1 hypothetical protein -
QJP78_RS26430 (41376) 41376..41471 + 96 WP_000609148.1 DinQ-like type I toxin DqlB -
QJP78_RS26435 (41536) 41536..41712 - 177 WP_001054897.1 hypothetical protein -
QJP78_RS26440 (42104) 42104..42313 + 210 WP_000062603.1 HEAT repeat domain-containing protein -
QJP78_RS26445 (42385) 42385..43047 - 663 WP_000644796.1 plasmid IncI1-type surface exclusion protein ExcA -
QJP78_RS26450 (43118) 43118..45286 - 2169 WP_000698354.1 DotA/TraY family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..86720 86720


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5775.13 Da        Isoelectric Point: 8.7948

>T280451 WP_001331364.1 NZ_CP124477:40400-40552 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 63 bp

>AT280451 NZ_CP124477:c40350-40288 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5W9M382

Antitoxin

Download structure file

References