Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 95057..95299 | Replicon | plasmid pAVS0969-A |
| Accession | NZ_CP124476 | ||
| Organism | Escherichia coli strain AVS0969 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | QJP78_RS25960 | Protein ID | WP_001372321.1 |
| Coordinates | 95057..95182 (-) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 95259..95299 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP78_RS25920 (90174) | 90174..90401 | - | 228 | WP_001254388.1 | conjugal transfer relaxosome protein TraY | - |
| QJP78_RS25925 (90489) | 90489..91166 | - | 678 | WP_001348626.1 | PAS domain-containing protein | - |
| QJP78_RS25930 (91300) | 91300..91683 | - | 384 | WP_001151566.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| QJP78_RS25935 (92120) | 92120..92617 | + | 498 | WP_113391481.1 | transglycosylase SLT domain-containing protein | - |
| QJP78_RS25940 (92914) | 92914..93734 | - | 821 | Protein_110 | DUF932 domain-containing protein | - |
| QJP78_RS25945 (93852) | 93852..94137 | - | 286 | Protein_111 | hypothetical protein | - |
| QJP78_RS25950 (94436) | 94436..94609 | + | 174 | Protein_112 | hypothetical protein | - |
| QJP78_RS25955 (94607) | 94607..94837 | - | 231 | WP_001426396.1 | hypothetical protein | - |
| QJP78_RS25960 (95057) | 95057..95182 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| QJP78_RS25965 (95124) | 95124..95273 | - | 150 | Protein_115 | plasmid maintenance protein Mok | - |
| - (95259) | 95259..95299 | - | 41 | NuclAT_1 | - | Antitoxin |
| - (95259) | 95259..95299 | - | 41 | NuclAT_1 | - | Antitoxin |
| - (95259) | 95259..95299 | - | 41 | NuclAT_1 | - | Antitoxin |
| - (95259) | 95259..95299 | - | 41 | NuclAT_1 | - | Antitoxin |
| QJP78_RS25970 (95326) | 95326..96694 | - | 1369 | Protein_116 | IS3-like element IS150 family transposase | - |
| - (96742) | 96742..96928 | - | 187 | NuclAT_0 | - | - |
| - (96742) | 96742..96928 | - | 187 | NuclAT_0 | - | - |
| - (96742) | 96742..96928 | - | 187 | NuclAT_0 | - | - |
| - (96742) | 96742..96928 | - | 187 | NuclAT_0 | - | - |
| QJP78_RS25975 (96897) | 96897..97659 | - | 763 | Protein_117 | plasmid SOS inhibition protein A | - |
| QJP78_RS25980 (97656) | 97656..98090 | - | 435 | WP_000845940.1 | conjugation system SOS inhibitor PsiB | - |
| QJP78_RS25985 (98145) | 98145..100102 | - | 1958 | Protein_119 | ParB/RepB/Spo0J family partition protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / sul1 / qacE / aadA5 / blaCTX-M-27 | senB | 1..130369 | 130369 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T280446 WP_001372321.1 NZ_CP124476:c95182-95057 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 41 bp
>AT280446 NZ_CP124476:c95299-95259 [Escherichia coli]
TTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
