Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HTH_XRE |
| Location | 3699591..3700270 | Replicon | chromosome |
| Accession | NZ_CP124475 | ||
| Organism | Escherichia coli strain AVS0969 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1PK60 |
| Locus tag | QJP78_RS18610 | Protein ID | WP_000057523.1 |
| Coordinates | 3699968..3700270 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | S1QAY3 |
| Locus tag | QJP78_RS18605 | Protein ID | WP_000806442.1 |
| Coordinates | 3699591..3699932 (-) | Length | 114 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP78_RS18595 (3695835) | 3695835..3696767 | - | 933 | WP_000883041.1 | glutaminase A | - |
| QJP78_RS18600 (3697029) | 3697029..3699533 | + | 2505 | WP_000083947.1 | copper-exporting P-type ATPase CopA | - |
| QJP78_RS18605 (3699591) | 3699591..3699932 | - | 342 | WP_000806442.1 | HigA family addiction module antitoxin | Antitoxin |
| QJP78_RS18610 (3699968) | 3699968..3700270 | - | 303 | WP_000057523.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QJP78_RS18615 (3700403) | 3700403..3701197 | + | 795 | WP_000365147.1 | TraB/GumN family protein | - |
| QJP78_RS18620 (3701401) | 3701401..3701880 | + | 480 | WP_000186633.1 | Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK | - |
| QJP78_RS18625 (3702048) | 3702048..3702704 | + | 657 | WP_015674862.1 | hypothetical protein | - |
| QJP78_RS18630 (3702701) | 3702701..3703204 | + | 504 | WP_000667000.1 | hypothetical protein | - |
| QJP78_RS18635 (3703242) | 3703242..3704894 | - | 1653 | WP_000771748.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11809.44 Da Isoelectric Point: 10.3980
>T280438 WP_000057523.1 NZ_CP124475:c3700270-3699968 [Escherichia coli]
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
MAQKKNIRSFRDAWLADFFVHSTPHRKIPAEIHTTLSRKLDIINAATSHRDLRSPPGNRYEELSGKLQEYSSIRVNKQYR
LIFKWVNGKAEELFLDPHNY
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|