Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 43223..43487 | Replicon | plasmid pAVS0973-C |
| Accession | NZ_CP124474 | ||
| Organism | Escherichia coli strain AVS0973 | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | U9Z417 |
| Locus tag | QJP95_RS25820 | Protein ID | WP_001387489.1 |
| Coordinates | 43335..43487 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 43223..43285 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJP95_RS25805 (39325) | 39325..40395 | - | 1071 | WP_000151588.1 | IncI1-type conjugal transfer protein TrbB | - |
| QJP95_RS25810 (40414) | 40414..41622 | - | 1209 | WP_000121263.1 | IncI1-type conjugal transfer protein TrbA | - |
| QJP95_RS25815 (41929) | 41929..42708 | - | 780 | WP_275450201.1 | protein FinQ | - |
| - (43223) | 43223..43285 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (43223) | 43223..43285 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (43223) | 43223..43285 | - | 63 | NuclAT_0 | - | Antitoxin |
| - (43223) | 43223..43285 | - | 63 | NuclAT_0 | - | Antitoxin |
| QJP95_RS25820 (43335) | 43335..43487 | + | 153 | WP_001387489.1 | Hok/Gef family protein | Toxin |
| QJP95_RS25825 (43559) | 43559..43810 | - | 252 | WP_001291964.1 | hypothetical protein | - |
| QJP95_RS25830 (44311) | 44311..44406 | + | 96 | WP_000609148.1 | DinQ-like type I toxin DqlB | - |
| QJP95_RS25835 (44471) | 44471..44647 | - | 177 | WP_001054898.1 | hypothetical protein | - |
| QJP95_RS25840 (44830) | 44830..45039 | - | 210 | WP_001140543.1 | hemolysin expression modulator Hha | - |
| QJP95_RS25845 (45137) | 45137..45751 | - | 615 | WP_000578648.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| QJP95_RS25850 (45827) | 45827..47995 | - | 2169 | WP_000698360.1 | IncI1-type conjugal transfer membrane protein TraY | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaCTX-M-15 / blaTEM-1B | - | 1..91072 | 91072 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5761.10 Da Isoelectric Point: 8.7948
>T280421 WP_001387489.1 NZ_CP124474:43335-43487 [Escherichia coli]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
Antitoxin
Download Length: 63 bp
>AT280421 NZ_CP124474:c43285-43223 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|