Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 43223..43487 Replicon plasmid pAVS0973-C
Accession NZ_CP124474
Organism Escherichia coli strain AVS0973

Toxin (Protein)


Gene name pndA Uniprot ID U9Z417
Locus tag QJP95_RS25820 Protein ID WP_001387489.1
Coordinates 43335..43487 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 43223..43285 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJP95_RS25805 (39325) 39325..40395 - 1071 WP_000151588.1 IncI1-type conjugal transfer protein TrbB -
QJP95_RS25810 (40414) 40414..41622 - 1209 WP_000121263.1 IncI1-type conjugal transfer protein TrbA -
QJP95_RS25815 (41929) 41929..42708 - 780 WP_275450201.1 protein FinQ -
- (43223) 43223..43285 - 63 NuclAT_0 - Antitoxin
- (43223) 43223..43285 - 63 NuclAT_0 - Antitoxin
- (43223) 43223..43285 - 63 NuclAT_0 - Antitoxin
- (43223) 43223..43285 - 63 NuclAT_0 - Antitoxin
QJP95_RS25820 (43335) 43335..43487 + 153 WP_001387489.1 Hok/Gef family protein Toxin
QJP95_RS25825 (43559) 43559..43810 - 252 WP_001291964.1 hypothetical protein -
QJP95_RS25830 (44311) 44311..44406 + 96 WP_000609148.1 DinQ-like type I toxin DqlB -
QJP95_RS25835 (44471) 44471..44647 - 177 WP_001054898.1 hypothetical protein -
QJP95_RS25840 (44830) 44830..45039 - 210 WP_001140543.1 hemolysin expression modulator Hha -
QJP95_RS25845 (45137) 45137..45751 - 615 WP_000578648.1 plasmid IncI1-type surface exclusion protein ExcA -
QJP95_RS25850 (45827) 45827..47995 - 2169 WP_000698360.1 IncI1-type conjugal transfer membrane protein TraY -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaCTX-M-15 / blaTEM-1B - 1..91072 91072


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5761.10 Da        Isoelectric Point: 8.7948

>T280421 WP_001387489.1 NZ_CP124474:43335-43487 [Escherichia coli]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 63 bp

>AT280421 NZ_CP124474:c43285-43223 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9Z417

Antitoxin

Download structure file

References