Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4632440..4633042 | Replicon | chromosome |
| Accession | NZ_CP124467 | ||
| Organism | Escherichia coli strain AVS0747 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | S1P416 |
| Locus tag | QJB08_RS22450 | Protein ID | WP_000897302.1 |
| Coordinates | 4632731..4633042 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QJB08_RS22445 | Protein ID | WP_000356397.1 |
| Coordinates | 4632440..4632730 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QJB08_RS22415 (4627747) | 4627747..4628676 | + | 930 | WP_000027696.1 | formate dehydrogenase accessory protein FdhE | - |
| QJB08_RS22420 (4628858) | 4628858..4629100 | - | 243 | WP_001068514.1 | CopG family transcriptional regulator | - |
| QJB08_RS22425 (4629390) | 4629390..4630238 | + | 849 | WP_001038650.1 | hypothetical protein | - |
| QJB08_RS22430 (4630263) | 4630263..4631003 | + | 741 | WP_000608806.1 | hypothetical protein | - |
| QJB08_RS22435 (4631188) | 4631188..4631406 | - | 219 | WP_001251293.1 | CopG family transcriptional regulator | - |
| QJB08_RS22440 (4631803) | 4631803..4632081 | - | 279 | WP_001296612.1 | hypothetical protein | - |
| QJB08_RS22445 (4632440) | 4632440..4632730 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| QJB08_RS22450 (4632731) | 4632731..4633042 | - | 312 | WP_000897302.1 | hypothetical protein | Toxin |
| QJB08_RS22455 (4633271) | 4633271..4634179 | + | 909 | WP_001385591.1 | alpha/beta hydrolase | - |
| QJB08_RS22460 (4634243) | 4634243..4635184 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| QJB08_RS22465 (4635229) | 4635229..4635666 | - | 438 | WP_000560981.1 | D-aminoacyl-tRNA deacylase | - |
| QJB08_RS22470 (4635663) | 4635663..4636535 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| QJB08_RS22475 (4636529) | 4636529..4637128 | - | 600 | WP_001296610.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4629390..4639692 | 10302 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12203.19 Da Isoelectric Point: 9.7791
>T280397 WP_000897302.1 NZ_CP124467:c4633042-4632731 [Escherichia coli]
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLNDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|